<?xml version="1.0" encoding="UTF-8"?>
<itemContainer xmlns="http://omeka.org/schemas/omeka-xml/v5" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://omeka.org/schemas/omeka-xml/v5 http://omeka.org/schemas/omeka-xml/v5/omeka-xml-5-0.xsd" uri="https://nam.maydayrooms.org/items/browse?collection=7&amp;output=omeka-xml&amp;page=1" accessDate="2026-04-14T11:55:22+00:00">
  <miscellaneousContainer>
    <pagination>
      <pageNumber>1</pageNumber>
      <perPage>10</perPage>
      <totalResults>41</totalResults>
    </pagination>
  </miscellaneousContainer>
  <item itemId="366" public="1" featured="0">
    <fileContainer>
      <file fileId="382">
        <src>https://nam.maydayrooms.org/files/original/9f28ce20abfd1ddf4727e0e373c0f2b6.pdf</src>
        <authentication>aa2d91436be5ad766747985f93e7fa7c</authentication>
      </file>
    </fileContainer>
    <collection collectionId="7">
      <elementSetContainer>
        <elementSet elementSetId="1">
          <name>Dublin Core</name>
          <description>The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/.</description>
          <elementContainer>
            <element elementId="50">
              <name>Title</name>
              <description>A name given to the resource</description>
              <elementTextContainer>
                <elementText elementTextId="13">
                  <text>Trade Unions and Architecture</text>
                </elementText>
              </elementTextContainer>
            </element>
            <element elementId="41">
              <name>Description</name>
              <description>An account of the resource</description>
              <elementTextContainer>
                <elementText elementTextId="14">
                  <text>Themes included action on asbestos and Health &amp;amp; Safety, and involvement with Direct Labour Organisations and Building Unions. Following comparative research of possible options, NAM encouraged unionisation of building design staffs within the private sector, negotiating the establishment of a dedicated section within TASS. Though recruitment was modest the campaign identified many of the issues around terms of employment and industrial relations that underpin the processes of architectural production.</text>
                </elementText>
              </elementTextContainer>
            </element>
          </elementContainer>
        </elementSet>
      </elementSetContainer>
    </collection>
    <elementSetContainer>
      <elementSet elementSetId="1">
        <name>Dublin Core</name>
        <description>The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/.</description>
        <elementContainer>
          <element elementId="50">
            <name>Title</name>
            <description>A name given to the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2026">
                <text>Is this the End ?</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="49">
            <name>Subject</name>
            <description>The topic of the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2027">
                <text>Flyer/ Report on low membership of TASS</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="41">
            <name>Description</name>
            <description>An account of the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2028">
                <text> MOTION&#13;
ISTHISTHEEND 2&#13;
After four years of organising we find ourselves with a disappointingly low membership in asingle London Branch within TASS that owes more to the initial sympathies of the now retired National Organiser than to our size or financial contribution.&#13;
Our small membership is standing in the way of further recruitment and is placing the burden of branch organisaiton onto the shoulders of too few people to&#13;
engage in the scale of programme required for an affective recruitment drive. Though TASS have to date, been generous with financial support, the effect&#13;
and ideas for promoting trade unionism within architect's offices have always&#13;
had to come from within the Branch. This has tended to result in all recruitment activities and events, no matter how successful in themselves, ultimately&#13;
failing through not being followed up.&#13;
Our present situation makes it imperative that a drastic change takes place&#13;
in our organisation to permit future growth rather than continued stagnation&#13;
and ultimate dissolution. A move to under the wing of STAMPis the logical step&#13;
we must now make. Such a move should involve members moving en mass rather than transferring individually. In this way we can have a say in the conditions of our new home. (Unofficial discussions suggest that this would be acceptable to both TASS and STAMP).&#13;
Once in STAMP wewould have:&#13;
A branch of 600 members of which 20% are ‘architects’ in the London area.&#13;
This would double our potential activists and give us a membership stake&#13;
in an overall union that we do not have at present. This is important in any union where branch representation and funds are proportional to membership figures.&#13;
a parent Union more sympathetic to our environmental concerns and more susceptible to revitalisation from within than TASS has ultimately proved.&#13;
A parent Union who have as great a voice within the Construction industry as the RIBA and who will be relied upon by the next Labour Government for advice on the future of this industry.&#13;
An organisation with closer links to local authority planning and building departments than we have previously possessed. Such a liaison is essential to our drive within the private sector.&#13;
an organisation within the Construction industry that embraces the other disciplines of building designers that we have always aimed to recruit but have never been able to.&#13;
An undispute claim that we are the sole Union for everyone employed within the building design private sector.&#13;
If you support trade unionism for all staff who work in building design offices, then you must attend an extraordinary meeting called by the Branch Council for Tuesday 26th May, 1981. A motion has been tabled&#13;
by the Branch Council with the last two Branch Chairman as proposer and seconder.&#13;
POLYTECHNIC OF CENTRAL LONDON, 415 NEW CAVENDISH STREET, W.1&#13;
5MAY 6.30&#13;
DING DESIGN STAFF&#13;
_ ORJUSTTHEBEGINNING!&#13;
This Branch believes that the cause of trade union organisation in the&#13;
building design sector can be best advanced by UCATT and thereby calls upon&#13;
all its weibers and supporters to move en bloc into a revitalised white collar section of UVATT.&#13;
TASS Bul&#13;
TUES 21&#13;
&#13;
 “suequeu uopuo] ey uo puedep pinom dtysuoTyzeted styy JO BuTyWOM sul “Sez&#13;
“SWLSV ‘¥S°OTD ‘ODTIVN ‘VOV ‘nyg Ba sqseuequT TeunqoeqtTyoue Sutqueseudeu (uoTun-uou pue uoTun Y40q) suotyestuesuo uayu4yo YyytM dtysuoTtzeted ButyI0M e yuoddns uotun 3uy pTNoM&#13;
“OOO'T# Jnoqe 04 Zutqyunowe ssoud Teotuyosy ayy ut uSTedweo pe T[Teus ‘JeTJeeT mou e YqTM ustedueo quewytnioed snotues e yuoddns 04 pauedeud eq p[nom LLVON yeUuy PeqeoTpuT sey Jestuesuo&#13;
[Teuotyeu utey, ~*suotzyeoTtIngd umo sqt 4eAo ToOuyUOd TINJ sey qWNYLS ‘“eUuTYOeM Aytottand ayy st se ‘aoTJJo peay ye peuqueo ST qyueuquedep Yyoureseu ¥&#13;
SUOTJeTJOSeu uT soueysTSsse apTAoud ueo oYM SJesTues4O SUT TINS OgT sey LLIVON *(098 epueSedoud ‘yourased ‘suoTqzetyo#eu ut pte 3a) sueyUOM TeOTUeTO pue TeoTuYyos4 ffeuotssejoud jo spaeu&#13;
aeTnotqued euy quoddns 04 uodn Meup uoTuf ayy uv SaduNOSed dJeTnotqued 1eyM&#13;
{Sdaquew UsMOM 04 apnyTyWZe eUQ ST qeum gdtusuequew uotun TTnNjJ doy aTATSTTS eq Jyeqs pefoTdue Aouase p[nom ggjeys quoddns pue [TeotueTo pue [euotssejoud ustsep Sutptting - soTjjo UT JjJe4ys T1y estueZu0 ysnu 4T 4eUy atdtoutud ayq ydeooe uotun ey. se0d&#13;
é}UawaAOW UOTUN apetz au apTsyno pue uTYUITM AYTITQTpato asooT 02 yOu se os fem&#13;
@aTRTSOd e UT yUsUdNOIZ3aI ayy 7ZOaTJa aM OP MOY £1039aS MO soy ATTeotgytoeds uotug mau e dn yas am pTnoys faoeTd ayeq queudnoz%a1 e yons pTnoys uotTun YoTYA UT :aze patemsueun&#13;
Sutuyewsart suotysenb ayy *1079as ano UT WsTUOTUN apetz FO ydaouoo au 03 snjzedmt mau aaTZ pue uaping eat ZseyYsTUTUpe sayz USTUTUTP PTNOM UOTUN auO OJUT STENPTATPUT pazzTMUOS Fo jUsu&#13;
-dnouZay"sn Zutuazreaystp pue 1039e9s IMO UT uUSTUOTUN apteZ JO UAZMOIZ ayy Zutpedwmt st suotun jUuatassTp oJUT 10}Z0aS uno uy gsye3Zs JO UOTSTATP auy pue sweTqoud seTTwTS BuToey ase suotun Jayjzo UT san¥eat[oo ang ‘uotun &lt;mo ZuTptinq 105 aseq WITS TeTQUassa ay} eptTaocud pue YT JeystuTWpe OF atdoad JO juoUus ST YyoUeIg ano ‘pueqs am sy *drysiequem ut Jyeys ugtsap SUTPTtIng 10j9as ajzeaTid yztm uotun ATUO ayy jOU ST SSVL&#13;
yeqeqisnsed 04 BuTT{Tts Aven oue Aoyuy YOTUM ,SMAN dWVLS, PeTTeo uotyeottqnd ATuaquenb e sonpoud 04 pesn qWVLS “Aaysnput SutTpTing eyz UTYITIM SeNSSsT uo SaqyeuqueoUODD ATSNOTAgO yoTUM ‘Aueqeu0eg [Teueaues ayy Aq paytpe&#13;
*paaatTyoe jou aaey aa stuy *dryssequem atqeazts e 10f adoos sem arauy 2eY Way PaodUTAUOD am asnedeq Yyouetq ysTTeToeds e sn&#13;
A[Teutwou pue ATYyQUoM peysttqnd st ;quTOdmMeTA ILvyoOn, azededsmeu uotun ¥ $4STxe suoTzeotTtgnd uotun 4euM *sueTqoud&#13;
pajuess aaTynoexg ayy “aToym e&amp; se SsyZ 0} Sat TTTqtsuodser S3T 3623103 03 YOuerg amo s0y Asea sT YI “YoueIg aTqeTA pue aat}oasge ue aq ev am 3eUR UOTUN a43 OF a4eIZSUOMaD ues aM ssatun sn uodn passoyz aq Aew yoTyM auo pue uotydo&#13;
Aue 4noyjtm voy pted aue (494 3eT smeu ATYyQuou ‘eZeqsod eT) aunytpuedxa aTqeuosead TTy “pung queudoTeaeq youeug 9yq4 Spuemoy so08 uotydtuosqns suequew yore Jo %G°) *xoudde -{TeH AqunoD ye ATYQUOMU syeeuM YyourRUq sul&#13;
ue st ‘youerg ay} FO jZUaUpUeGsTP ‘asToaId aizow aq 03 ‘10&#13;
{-zyeqs Teuotssejoud eue %GT yoTYUM Jo 0OL ynqoe st dtysuequeu dn pted uopuoy 24T 09 OTQeTTeAe aue SseodunOSsed 4euM 4990 4I seop eueym pue uaqjo moH ZyoUeug UOpUOT 294A jo drysuequeu euy ST JeUM “(PETTTZ Jou saey Adu YOTUM) NOUV&#13;
uo 4ees © OF peT4T4IUS ST qWYLS pue dtysuequeu UT SsqzoeqTYyouy O02 sao sue aueu, *S4eT} JeMOT 94 Se seyoUerq pue szOoTU4STp ‘(STTOUNOD TeUOTSTATP Uno) oTSau uqtImM Seunqonuys uotTun ayy jo uatq doq 9y4 ST STYUL *98944TMWOD SATINOSXY&#13;
auy uo yeas e sey SLLVON ‘UOTUN BuTpPTINg eYyq jo UOTIOSS AeTTOO 94TYUM uy se ‘dWVLS ‘Suequem 9044TuMOD SATYNOeXY eUTI TInJ e Aq yuseseud ye peuteyo ST YOTYUM 9044TUMOD TeUOCTJeU peyoeTe ue Aq payeUTP4O-09 21B OUM&#13;
geyoueiq G2 Jeao sue susu_ “weey SuUTpPTInq Teuotssejoud eyy pue jjeqs a4IS SuTpling uotues Buowe sestueZsio pue suequeu pted 00G‘h seu dWWIS *peqeutpuo-oo feyqy aue MOY gaueuy sue sayoueuq GWVLS Aueu MOH ZpeqtTnuded 4T sey Susqueu pue&#13;
Jjeys Jo setuoZeqeo qeum ZdWVLS jo dtysuequeu queseud 9yuy ST 7eUuM&#13;
gut yu0m fayy aoTIJO jo azts jo adfq 4yeyum uweqqeu ou ‘seoTjjo usTsep BSutpting ut jjeqs&#13;
pestueSuoun [Te esTueZu0 04 ATaATIOe aTqe pue BuUTTTIM uoTun euq ST [tTouno) youeug gWWLS Pue SSYL JO Suequeul ueeMyeq sSuTyeeu 2 jo quodey&#13;
SUdIOM UO 94eIq¥UaDUOD 04 9aqqTMWOD-qns&#13;
qdoooe 03 SUTTTTM 8q PInom ‘(SsyL ut se) dnous suewom Aue sapun postuesuo&#13;
qou uSnouyTe oum ‘suequem uewoM COO‘) Sue sueUuL “snqeqs drysuequeu&#13;
Ting a0oy gyeqys pekotdwa AoueBe sqdeooe ATqeooaTnbeut&#13;
au} O4UT pesTueSu0 eq 4snm ecTsjo ue UT Jzeqs TIy 3euy sqdeoo0e qWV1S&#13;
“Sensst TeUOCTJeU eB JO JUSUYSTTQeIse 8yy&#13;
4] “uoTun sues&#13;
, £poqeg se tty Aq quTOdMoTA SATZeCUTEITY uy&#13;
’ “MON ee3S 2e ST uOTUN moO fo&#13;
Sok&#13;
os MOTSq ST pue 4Sey ZuTTtTesy st dtysasquem dn-pred mou&#13;
“0&#13;
: INAWENOUDTY&#13;
oe *iayj}e303 Yyouerg ayy poy 03 4nd piey oq&#13;
PTNom, am 3OU PTP 4T FI “uoTUN SY SpPTSyno pue UTYTA aor10F TnyZuTuesw e awodaq PTNOM youeIg 3ay} PIP 4E JI “Tetjuassa aq Ptnom drysiaquieu amo fo pity} e&amp; YseaT 7e FO yUawWZAZTUMOD&#13;
®ATZOR BYR Paadons 03 UsTeduweo e yoNs sOg *ButTzzeTseaet&#13;
pue sZupjeeuw TeOOT aatTsuaquT yiTM peTdnos etpaw ayy Fo uot eInzes YZno1yy ustedweo aatyOaz=za ue 03 ATazatTduos zaAo FT9SIT aaTZ ued youerg ayy paptaoid ‘1a349aq uaaq JaAauU aaey&#13;
SaTITTTQtssod quamztnioar samyny satyy 10F Insszeayz szeqs Auew yitm *sefoTdua pue safoTdwa usamjeq ARTImdes pue samod FO saTzTTenbeut ayy BJutAytuelo ase satuetes pue yIOmM Fo SUOTZTPUOS UO SaiINZOT.13s pue 1039aS mo ut jyuewAoTdus ZSuTTTey&#13;
‘uoTSssacdal aU, “WSTUOTUN apery 03 pazyTuMOD ATTeOTZOTOapt STeNpTATpuT puofaq peyoear Jeasu sey dtysisequeu youeig&#13;
2:pezoou Usaq aAeY STSTID |ay 09 Sasuodsar aaT eUIayTe aay Sdaqueul yYoUeIg euos Zuowe suOoTSsnosTp TewiosuT uy&#13;
uoT eUsTSaI juader © BUTMOTTOS uosuaditeyo e yNOUYTA are aM&#13;
pue snoy ATuUO saqumu mou youerg ayy FO STetotsFO&#13;
ua} ueYy. sseT saZveraae mou pue uaTTey OsTe sey sZutTzvew youeig ye Souepuszze&#13;
pue OOL papssoxe uaaau sey yeaed eyTt ze AtTysiequou&#13;
NOILYNOISaY&#13;
INAWLINYDTY&#13;
“SHUNINA TWNINN UNO SSNISIG OL ONCTV . GWOD GNV SONIISSW HONVYd OML IX3N SHL JO SONINSAR SHL NO SINAWIOVONS YSHLO ANV GCISV INd OL SUSGWSW HONVUd TIV OL Tvaddv&#13;
TvIO0adS V GMVW OL CHONRINI SI SLON SIHL AHM SI LVHL&#13;
*uMO S}ZT uo amyny Zutpuedxe pue amoas e IOF asumoo e ojUO YoUReIg ay} Jaaqs 0}&#13;
aTge aq ZOU TITM [TOUNOD YyoUeIg ayy :1eaTo st Z3uTYyy aU&#13;
*apecep e Aq 49eq Yas aq TITM 1099aS smo ut sye4S papuesep pue pastueZio AT1adoid e Jo uoTSTA ayy 4T ayey&#13;
3,UO0p eM JIT “sey OS ATTNq aaey am dnowd [Tews ayy 18y3e704 PToy 03 aoueys auo ATUO dSaeYy MOU am ‘BuTYyZAUe Ueaul 04 ST seotzoeid ustsap Zutpttnq 1030es ayeatad ut wstTuotTum apes fT&#13;
*quaupuegsTp ueou ATutTezIe.2 ptnom ynq yno yTads uaaq you sey aaTzeU ~1azTe ay] *tapso ut ysuerg smo 3nd 03 sn sox uoTuUA&#13;
ayy Aq‘ ATqepuejsuspun ‘pattdde Zutaq st Sunsset&#13;
:qgutod ststao e 3e sft ysueig smo&#13;
</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="39">
            <name>Creator</name>
            <description>An entity primarily responsible for making the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2029">
                <text>Giles Pebody</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="48">
            <name>Source</name>
            <description>A related resource from which the described resource is derived</description>
            <elementTextContainer>
              <elementText elementTextId="2030">
                <text>John Allan</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="40">
            <name>Date</name>
            <description>A point or period of time associated with an event in the lifecycle of the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2031">
                <text>May-81</text>
              </elementText>
            </elementTextContainer>
          </element>
        </elementContainer>
      </elementSet>
    </elementSetContainer>
  </item>
  <item itemId="367" public="1" featured="0">
    <fileContainer>
      <file fileId="383">
        <src>https://nam.maydayrooms.org/files/original/992f78476d856d3d85e07388b3f6acc8.pdf</src>
        <authentication>59e110c6806ebabe33bd42022fca09da</authentication>
      </file>
    </fileContainer>
    <collection collectionId="7">
      <elementSetContainer>
        <elementSet elementSetId="1">
          <name>Dublin Core</name>
          <description>The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/.</description>
          <elementContainer>
            <element elementId="50">
              <name>Title</name>
              <description>A name given to the resource</description>
              <elementTextContainer>
                <elementText elementTextId="13">
                  <text>Trade Unions and Architecture</text>
                </elementText>
              </elementTextContainer>
            </element>
            <element elementId="41">
              <name>Description</name>
              <description>An account of the resource</description>
              <elementTextContainer>
                <elementText elementTextId="14">
                  <text>Themes included action on asbestos and Health &amp;amp; Safety, and involvement with Direct Labour Organisations and Building Unions. Following comparative research of possible options, NAM encouraged unionisation of building design staffs within the private sector, negotiating the establishment of a dedicated section within TASS. Though recruitment was modest the campaign identified many of the issues around terms of employment and industrial relations that underpin the processes of architectural production.</text>
                </elementText>
              </elementTextContainer>
            </element>
          </elementContainer>
        </elementSet>
      </elementSetContainer>
    </collection>
    <elementSetContainer>
      <elementSet elementSetId="1">
        <name>Dublin Core</name>
        <description>The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/.</description>
        <elementContainer>
          <element elementId="50">
            <name>Title</name>
            <description>A name given to the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2032">
                <text>AJ/TASS Survey</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="49">
            <name>Subject</name>
            <description>The topic of the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2033">
                <text>Major Survey of Salaries and Conditions of Employment</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="41">
            <name>Description</name>
            <description>An account of the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2034">
                <text> eu} UT shuTUZeS UeTpeul&#13;
*sdnoip abe 67-07&#13;
aseYyhTYy ATeUuR Yorez&#13;
petzeTes sozeumiod SzeATId UT STTYM dnozbH&#13;
pue AzysnputT sjeatazd ehe zeAo pue og sn&#13;
s7oeATYyoOre ut pue eotjzoeId UT pepzr0Dez ere&#13;
sqoeqTyorze AYTAoyANe sqoeqtTyorze ATey,ZO pue&#13;
poTzerTes wr shuTuzes&#13;
JO obe Sua zea 3V *sdnoiz6&#13;
sqoeqTYyore oy AAAOZ abe soul uT spTetz jzuewXotTdue&#13;
49470 UT SZOSZTYOAZe&#13;
ueY sseT UZeS ssefkoTdue&#13;
sotzoeI1d&#13;
UTTM OeSsesrOUT UOTJeASUNUIST&#13;
ATEYR Ses 09 AOSdKSe uoT}eASUNUISY PUe SOUSTASaxXT&#13;
esoi shutuzes uetpeu UI “8L6T 403 ggEe'9F&#13;
“6L46T UF OSS'9F O23 %B°TT Aq eyj ‘sozeui0s pue AAASNput e7zeatad&#13;
ebutzy zeyjO pue&#13;
*(Aed ouwtqZzsao0 pue sytyoueq&#13;
TedoT zAoZ sHhutuzese uetpeu&#13;
sot IOerzd eReatTad uT uetpew usemjeq soueZezZJTp&#13;
Se7zeATad 3eyR smouSs STUL °9STQel UT uMoUS ST PTETI quewAoTduse pue ebe Aq shHutuzee ueTpeu Jo stsATeue ue pue ‘UOT&#13;
é7eoTITTenb azeqze szeok 4satz yj ut ATzeTNotTyzzed souetrzedxes&#13;
FO SanHbtz e HutathH&#13;
Asazns wary ey&#13;
UATM 6LET UT OOL'9F 03 %O°S6 AQ peseeroUT sjZdeqTYoOIe ARTz0yANe TeooT Jo shutuzes uetpeu oy uostzeduiod ut&#13;
Hutszeys 4Tzoad&#13;
Sexe ez0z7eq '*°e8°T) 6L6ET ATenuep T uo se AzetTes ssoxzb&#13;
Tenuue S47 UO peseq erie shuTures ueTpeul ey, “*UuOTIeTJUT ATM eoed desy 07 peTTey oaey sHhuturee s7ZoSATYyoOAe petazaetes TTezeAo snyz +%E°6 Aq peseezOUT xXEpPUT SoTIg TTeIEY&#13;
Azenuel UT OSB'9F OF BL6T Azentwep UT 6S9'SF WorZ %G°g Aq peseezout soe ;TYOAe PpeTAeTeS TTe Jo shutuzee uetpeu oyz&#13;
ey ‘TeAeMoy poTzed sty Hutznq *pEg'oF FO Q/ET oun UT syOeqTYyore TTe AOJZ uetpew wary e YUATM sereduios SsTUL “°6L6T&#13;
Zsoubty SUL&#13;
*ATQertepTsuod seseezDuT&#13;
‘sesnuogq Hbutpntoxe pue&#13;
NOLLVYENNWHa SLOELIHOU&#13;
sqZoeqRTYOAY&#13;
°G STqeL UT umoys se uotssezoid TeaznyzosATyore |yy FO %TL esTaduios oym ‘'ATUO peTzeTes syy UO sejezjUSOUCD Aeaang ssvL /OW SUL “sdnozb z9yZ0 ueYyA sseT eTqezepTsuos uzee oUM&#13;
spoeqtyorze petzeqTes sot joerd sqeatad Jo esed ey UT suUeTpeU UT souebszseaAtp AeptmM e smous Asaans SSWL/CW eu 'sq0eq4TYOTe AjTZ0yANe TeoOT se YoOnu se ysouTe HutTuzese sozeuoo pue&#13;
AAZSNpUT SRZeATAd uT sqQoeqTYoOAe petTzetes UATM ‘shuTuzes uT sTedtoutad sotzoeid eqeatid-o3 ATuo. puoses eize sosoAo dus&#13;
WuUSUUASACH TezjueD 72eYyR peqseHhHns saey sAeaans Zey.0 Yybnourtw&#13;
*“SPTSeTF JuswAoTdus ut pted 3semoT eyA&#13;
sueTulst TTTIS sqZOSRTYyOAZe peTazetTes jo dnoz6H styy ‘sksaans yRog&#13;
ur “8LeT SeUuNL AOF ANq 799'GF FO uetTpow Aeaans yaTY eyy YATM sezeduiod sTyUL “6L6ET Arenuel uT 0Gg9'GF 03 %z°G AG peseezouT sbhuTurzes uetpew eyj ‘sqjoeqTYyore peTzets Sot zoOeId&#13;
e7eATid Huowy “y STqeL ut umoys se jueuAdoTduie Jo ptetz o3 Hutpz000e ATqezeptTsuood seTreA uoTIeZEUNUIEAZ s7oeATYyoIAW&#13;
eu Aq pezeacD szeeA Jo requmMU ehzeT ey Jo esneodeq&#13;
pue eTduwes [Tews syz Jo esneosq sHhutuzes uo 410dez 03 eTqTssod useq jou sey ATezeunZAzOJUN 4AT 'OgG Jo apts zeyuAtTS szeeX Moy oy} UT peyorer yeed sHhuTuzes uetpeu oyQ UaTM&#13;
uoTZerSuNUSY Pue PTeta juSeWAO dug&#13;
&#13;
 ~oe7eyy o2e pue wzostun 03 Hutpzoso.e sesAoTdue&#13;
*SezSeYy ASYRANT YAIM ATeep you sezo0z&#13;
ATAtez sq 03 Aeedde sotTZyZo ARZTAoyANe TeooT z0z sHhuTuzee&#13;
*pepntTout jou ezO0jJez7eyUA ST pue&#13;
SeoTFFJO JO SZTSs Sy OF&#13;
pseucT ZzZOdde usyM TTeus&#13;
dnozH ehe zeA0 pue Og&#13;
6v OF OF SUR UT SCT'TF OF O€ SUF UT OEG’TF OF&#13;
AeA0 YFTM Ssoyuy pue Gg pue T Usemjeq ButAoTduse&#13;
usemyeq cogs Aq Azea&#13;
TOT seotzzo&#13;
ueTpeul UT SSoUerSeTITP&#13;
spToy sbutuzee eyj 2eq4eq&#13;
*sdnoz6H ebe ey [Te UT shutTuzee&#13;
MSTA pTey ATuouMIOD ATTeuCTITppe pue seoTFFO STTyzenb pue ueTpeu Seyj&#13;
styW ut enzR ayy Fo&#13;
eyj Worx esuodsez suy 03 seonpsez usey pue&#13;
sesesezoUT sTYyR pue ‘seeXoTdue&#13;
sHutTuzes uetpew dnoz6H&#13;
ebe o¢ Zepun eu UL&#13;
SeTqereptTsuod yATM ‘'Asaans&#13;
SYA SsOTRIOeId SYR ZebzeT&#13;
sy *sdnoz6 ehe anoz&#13;
pezts qUuSezTeTITp AOZ&#13;
smous / STQeL *seTjUNOD&#13;
eu} pue UOpucT UT pezerzUSDUOD aq Of pUsay Wey Jo ysow se&#13;
YSTNHuUTISTp OF FINOTJITP eze ezts soto pue UOTRZESOT usemzeq SeouresITP Sy (7eA0 pue Tg HbutAoTdue ssoyz ''a°t) seotzzo&#13;
ebreT FO esed sy UI “Jyeqs TeaznjoeqzTyorTe Jo Zequnu eyz&#13;
Aq peuTuzejzep se ‘eoTsyo eyj jo ezts ey. ST UOT IeTSUNUIEZ SZOSTJe YOTUM SOTFFO FO UOTReoOT ueyR Aooey Queqszodwt ezou y&#13;
°?&#13;
sya on Hutpz0s0e sHhutuzese&#13;
uoTZeASUnUISY pue UOTIeEDOT&#13;
Fo ezts uetpey&#13;
003 sem *dnoz6 ofe&#13;
dnozb obe EE&#13;
SUID&#13;
SOoTAOeAd SZeATAg UT UOTZeASUNnUISY pue SZTS SoTITFO&#13;
“uTeqyTrd 7eSeID JO suothsez 7ASyRO sya 03 pezeduoo ueym O09F OF OOEF USEeMzeq OF peoNnper st sous DIFJTp uy ySnoyate "ZSSM-YANOS Sy pue SeTeEM pue Ase_—-Yy4NOoS ey pue UOpUOT&#13;
USeEMjeq se jJUSpTAS Sie suUeTpoW ey} UT O0O0'TF FO sseoxe ut ssouszesFTd *rt070es SjZeATAd sy ut ATQeZepTsuod seseezoUT AT&#13;
‘3Ze8IH Jou st sqo0eqTYyore AqtazoyANe TeosoT z0j sbutuzes uetpou FSOMOT pue ZSeyhTYy ey, uUSseMjeq SoUeTEZITpP ouR YySnoyzte&#13;
"UOTIEDCT SOTFFIO JO swxz9z UI “*4sem-yANosg sey pue seTem UT FSOMOT puUe PUeTSII UASeYIAON pue UopuOoT uT yseySty eze Z0}70esS OTTGQnd sy UT shuTUZeS UeTpeu ZeUR oes OF eTQATssod&#13;
ST 3T ‘TeASMOH *puNosuN ATTeDTIAsTAeqIs eq Ue pue USASUN AteA ST peuotTjzodde useym eTdures ou3 esnedsq pueTeAL pue uTeqtag 7eezD FO suothberz eT sya pue dnob6za ebe on Hhutpz0s0e&#13;
uoTZezreuNUIST JO suoSTireduiod syeul 02 STQqTSssod useq jou sey 3T ‘ATezeuN_TOIUn «=UOCTZeTEUNWEeT Jo suosTieduios eyew o7 eTqtssod useq Jou sey 4T ATezeuN_ZAOZUH “UCT eASUNUIEZ SsqDeqTYOIe FoOeTFe UeO YOTYM AoOWZOeT ASYRZANZ e&amp; ST SOTJFO FO uotzeooy&#13;
*ebe sty Hutyoerer zeqze sHutuzee azteyy eseotOUT 7OU Op spTeTz yuswAoTdue ZeyZO UT sjdeqTYOIe TeNpTATputT Feyy HbuTuesw se pejyerzdzeqjut eq you pTnoys STUL °oeseoerOUT&#13;
TeuTbseu AeA e SMOYS YOTYUM sqdeqTYoOITe ARTAoyANe Teo.oT Fo&#13;
uoTydeoxs Sy} UFTM sjoOeaTYOAe peTzeTes TTe AOJF SUTTOSp of aeedde shutuzes uetpeu ‘0g puokeq 'ssetTeyzzeaen *stsATeue&#13;
PeTFejep e AOF MOTTE FOU seOop YoOTYM dnozbH she zeao pue OG&#13;
&#13;
 Mey YUATM Tedtoutzd syjz FO uot AerAOstp eyR ye sem SACST YOts pted fo potzed ey sotjzoerzd eqeatad ut usezFO *z03098Ss OTTqnd sya ut peAotTdwuse [Te ATArAeeu of pezreduoo SOU ZO syUOU 9g OF PSTIATIUSe e7eM SoTIOeAd sjeaATAd ey UT ehequeozed [Tews AzeA e ATUO esnedeq peyrAeW SzOW&#13;
USAS ST STORZOSS OMA SYR USEeMIOEq SoUSeTZeTJTp oyq 'AoAeMOH *sAep OZ ASAO OF PeTATIUS |ezZEM SOASuMIOD pue AAzAsnNpuUT SREATIG UT %/°99 pue sRZOSeQTYOAZe AAtTzAoyANe Ted9OT FO %z7°CE&#13;
STTyM sAep SAOW AO OZ OF PSTATIUS e7OM %/°G6E BSeEeAT SUA Fo °O peTatqjue ezem Assy SAeCST YOTS pted Jo potzed yeym&#13;
Pept OU PeY CUM (%Q°py) sROSATYoOAe sot IoOeId ejeaTad Jo ebequseozed ybty AzeA sya Sem ATNsea HuTyTAAs ysou seus&#13;
SACST YOTS Pted&#13;
*dnoz6h she og wpun ey ut %ET ATuo etTtym ‘'dnozb&#13;
ebe ASAO pue OCG Sy UT %TE Aq peAolCue oze AepttToy sAep Gz&#13;
03 TZ #eUR HuTMoys uMopyeerq peTTejep e seaTth FT STqeL *SsoTAZTSS OTTQqnd ut ssshoTdue putTueq TTeM TTez Aeyz stTyuR zeqAze ueAS ang ‘seoTAZes Jo szeeA oulos AeqRze juSeweTATIUSe AepTToy&#13;
PeseeAOUT SATSDSZ AOROSSs |RZeaAtTaAd oyA ut sssXkoTdue AuewW&#13;
*skep gt ATuo uotyz0doid queoTITUBTS e pue ‘'skep Oz ASspun evAey (%8L) seeAoTdue&#13;
ZozoSes SzeATIAd FsoWU STTYM (AOROSS SReATIAd.syA ut %z ATuo 03 perzeduios) zesA zed sAep o¢ 03 972 HutAoLus mou ssaAoTduie&#13;
zojzoes otTtTqnd jo AqtzoCeu sy ‘sz070eSs OTTQnd pue syzeatad ey uUseMjeq se WUSUETITIUS AepTTOY UT ASTXS Of SeNUTIAUOD SSoUsSTSTIJTP STQezeptsuods yey MoUs sqQTnsez ASaans SyL&#13;
sXept TOH&#13;
*poeyzeu ATSA YOU Sze SpTeTF WUewAoOTduse useMjzeq YSem Zed pexTOM sanoy FO Aequmnu sy Jo ssouezreFJTp oy smous €T eTqeL ‘*quewkoTdwe AqtTzoyANe TeooT ut (%z°zz)&#13;
ebejueoszed AemoT ATRUHTTS e YATM soASUMIOD pue AzYsNpuUuT eyeatTid ut syZoOseATYyoOTe |eze ySem ANOU GE OF TE e Hbutyzom pTEts queuxotTdue Aq (%0¢€) ebejueszed ysebzeT eu *yeem red sznoy&#13;
Of pue 9€ USeMISq YAOM sjoSeATYyoOAe peTreTeszsoW T[TezreAO SANOH&#13;
*sqoeqtTyorze AAtTzAoyANe TeodoT Huoure uowuwoo 3ZsSOUl ST SOURPMOTTE APD e FO UOTSTAOCAd SYA 3eYW MOUS syTNsez&#13;
Asamns euL “*sseutsnq AoF 7ZeD UMO ATER Hutsn suokue Az0;F TeSASATUN SsSeT AO SAOW MOU ere SSDUeMOTTe SheeTTU rzeD&#13;
"8 STASL UT umMoYS sT stsATeue UY “FTJeUSq STU YITM peptAord eze zo0j0es OTTQnd seyA uT ehbequeored AueDTJTUHTsuUT&#13;
ue uostzeduos ul ‘*sozeumoD pue AaqysnpuT eqjeatad ut %LE AjTzesu pue 7eD e&amp; YATM pepTAord oeze sqoeqTYoOAe peTzAetes sotzoerd ejeatid JO %zT AeAO Asne “*oeaeeT YOts pted&#13;
pue sAepttToy ‘ssousyos uotsued zedozd fo souesqe 3yy UT&#13;
ZozOes e7eATAdC Sy UT STQeTTeAe 4TyJoeuseq ,ehutTzz, STTUM “UAOM YsOU Sy} WeRFO ST uOTSTAOAd sty *sz0RDes OTTQnd pue ojeAtiad eyj seystnbutjstp ssn ajeatad pue ssoutsnq ZOFZ 7ZeD e FO UOTSTAOAd |yR 3eyA swztjzuoo Aseaans SyL&#13;
SOUPMOTTY Ae pue STeO LNYWAOTdWH JO SNOILIGNOO&#13;
&#13;
 eTqUeL UT uMOYS ST SOTFJO sepnqtaqe jo stsATeue peTtezep&#13;
pue AzZsnpuTt sejeatid ut&#13;
LQ 'S3ZOe4TYOZe AZTAoYANe&#13;
*s07EuMIOD&#13;
UFTM ‘ANOAeT UT %BE SA0M "%E°SG ST SUOTUN JO ANOAeF&#13;
petzeTes [Te AOF ey *peuTuexs 870M suOoTUN&#13;
Teuotssejozd Huowe sAeaans&#13;
%1G pue jueuIZeACH Te muses TeooT Huouwe AnoAez ut&#13;
uT %/&#13;
28S) %TZ 0} peseezOUT&#13;
SuUOTSUSg&#13;
“TLT STqeL umuTUTW AzZORZNRZeIAS SUR AZeAO Aed&#13;
Aouepunpesr HuTAtesez ejeAtsd Ul “*umMuUTUTW&#13;
eSejueorzed ey. sozeumi0o WAaIU oul %p°eoT pue umututu&#13;
euz ATUo HbuTaAteser sem 7OROeS OTTQnd syYL&#13;
pue Azisnput&#13;
AZ07N7eI4s&#13;
UNUTUTU PSpuSUMooer Waly&#13;
ey Hutatecsesz %e°T ATuo&#13;
Xed Aouepunpez umututwu&#13;
Azoqneqs ey. oF ATuo&#13;
yQTM peTAtTWIue ez0M&#13;
sqoeqtTyore petzetes&#13;
sotqzoerzd ejzeatad go&#13;
Aqtazolew j3Veerh oy Keq ADuepunpey&#13;
“9T STOeL UT UMOYS pue AzyZsnpuTt eqeatad&#13;
SL°LT ATUO UTM Az0jDes Szouw ZO anoz Hutatnbez&#13;
ST stsATeue peTteqep ut %e* TH pue e0T OeAd&#13;
“OT FO SZTS Of HutTpzo0ooe suotun o7&#13;
e sot joeid oS7eAtTisd uTUATM uoTUN © FO ANOACT UL — SoT Joerg SjeATAg&#13;
erSYyR ‘SeoTIOeId ojeatad&#13;
uT ehejueozed ey sqoeqTYyore&#13;
sTeeAezr ET STqeL FO stsAtTeue&#13;
OF Sepnytje 4eUuR UT seeXoTdue&#13;
uy osu SNOINN OL SHCALILLV&#13;
zeyjo worzz szezstp Aeaazns&#13;
%G°OL UTM reQ3eq ATQUeOTITUBTS “SsoTAZes Jo yAHueT of HutTpszoooe&#13;
yw °eozSuMUCD ejZeAtad ut sem soTWZOU SsyeeM&#13;
potied zebuoT e seiznsue 2t030es oTTQnd ey UT 4OerAUOD&#13;
OTTGQnd ey UT %z° Tp&#13;
szeAoTdue ssou, cseeXkoTdue&#13;
eyz pue aeKoTdue ey3 yaoq Aq jueuAoTdue FO UOT}eEUTUIISA JO SsoTZOU Fo&#13;
PeusTTqeiss pue eainoes&#13;
e Jo ehejueApe Hut{Tteaerzd qUsuAOTduUg FO UCT JeUTUSL,&#13;
*PTSeTF WusewroTdue Aq QueWSeTyTWUS&#13;
FO potzed eyz sMoys&#13;
GT STqeL “seuttTeptnS&#13;
pestubooez&#13;
ey uteby&#13;
4aATM&#13;
*sTeAeT AzeTes UATM peuZeoUCD sem sjUSpucCdsez Fey Fsebhns squsumod Meg “*sTeAeT AzeTes YATM peureoUCD&#13;
sem squepuodsez Aq spew juTod jueqzodut jsouw sya zez Ag&#13;
*HuoTeq seeXoTdue sqt jo Aqytaofew ReezhH ey YOTYUM OF Susyos uoT}ZeNUuUeZeEdNS UMO sqT sey AORDES OTTQNd SUL *“Sulsyos ees ey 03 HuoTeq %p°y ATuo °dn peddoj susyos e7ejs oOTseq ATeyW HSutaey %z°TT pue suleyos eqeqs eyj Fo 4no&#13;
HuTZOeTAUOD %Brz_L YATM ‘sorSuMIOD pue ATZsnNput eqeatad yATTTM sysezquoD STULL “sweyos szeAtid e yatTM dn peddoj suweyos oejeas oTseq ey sAey %g°z ATUO “*sMOUS BTeTaeE,se ‘ano&#13;
pejoezquoD HutAey ssoTtsyo %z°SGz YAM oweyos ejeqs ey. on HuoTeq AeASMOY 70ORZDeSs ejeATAd 9yA UT (%S9) AajtzoCeu yeerhH SUL “ST FSUSq JUSUIEATIZOA ASRZAEq ASyyJo sowseyos sqzeatad&#13;
‘peaordut yonw useq sey ewseyos uoTsued ejeqjs meu oyy ypnour tw&#13;
&#13;
 *,S8SZOM TO 7eRzAEeq AOZ, AUTISep ,,UMO,&#13;
ITye} JO ehbzeyo UT pue Aejsew&#13;
TENPTATPUT AITSeYyA UTeZUTeU pTnoys AeyA WeU ATEeF srSeyI0&#13;
“ezTSyMesTS jueuAoTdUIS Yyeoes pue SAeeT PTNOM&#13;
Assy usey} ‘suey roeqqeq eReTAobeu&#13;
peTsstizesstp ez0em Ay FT&#13;
Sssou; JO “UOTZeNATS ey qanjstp&#13;
Sezojsoerey, pue ‘SUuOTITpUCD Aeyy eu} 4FTeF squepuodsez&#13;
ATuo 3YyHTw suoTunNn pue sTeAeT AzeTes pooh pey&#13;
eseyZ go Auew *szeXotdus eq pTNoOd suoTzTpuos pue&#13;
YUITM ATTENPTATPUT PeSssnosTp sotzetTes ptes squepucdsez ezeyM&#13;
pue [Tews UT pexyTOM uOoTZeSsTUOTUN&#13;
seoTJJO ,Tewz0sutT,, O32 pesoddo ysou ssouL&#13;
,UMO, ATSYR eq O73 SqUYHTI&#13;
ATTeuoszed you PTnos pue 2eYR pequeumioD Auew ‘sjuspucdsez&#13;
*,SSOTJJO UT swoysnNd pue juseuEheuew Tepnesz,&#13;
ey Sutaocizdut ut uotun e Jo ontTea ey4 Mes AUSepUOCdseZ&#13;
“siequicul S3T ASFJO pTNoD&#13;
SoTApe Sy peuotTjueu sjzuepucdsez&#13;
sUO 4yaz0ddns pue&#13;
uoTun peystTqejse ue jeyW&#13;
JO SUOCTZTPUOD pue suze}&#13;
ue yONpuSCD pTNodD uotun e 3eYyj e7eM SpeU squUTOd zeY30&#13;
pue sTeAeT AzeTes Jo Yyooyo&#13;
Tenuue&#13;
mez yw *quewAoTdus&#13;
STaTFeducout sem dtyszequieul uotun zeYy AYyHnoyQ TIt3s zZequmu TTeus yw “suotun Sututol zzeqs azteyy jo ,eaznseetdstp, moys 7YybTW szeuqZzed ATSeYyRZ [nJzeezy ore sqoeqATYoTe AuewW&#13;
*ATSATIOSTTOO peqetqoHbeu eq oa peu ButyzAzeae 2yHnoyW AeysL uéSUOTFENFITS YIOM pue sqof juezezztp Auew os ystxe ezeyR USYyM seTZeTes YATM dTSy uoTun e pTNoOD moy, sem uot Zsenb&#13;
TeotdA, yw *oanjzeu oTseq eZOU e JO sem soUeTOUHT ‘eIOU SNoTz9ss ez0uUl 2 UO “SeOTFZFO ShreT ut eyzetadozdde Atuo st UOTFOS SATRIOSTTOO ey peutHbeut ATeptm eq o7 saeedde ar *sseAoTduie Teuotsseyjoxzd Hutjueseazdez suotun zeTToo SaTUM Fo&#13;
spoyyow pue SsToOr sy JO soueZOUHT suoOs ATAeSTO st ez9UL&#13;
suoTun JO ANOAeT UI ON SSOUL — SoTJoeIg oFeATIAg&#13;
*(uoTun butzseutTbue ey FO 10ROSSs AeTTOO eyTYyM 933)&#13;
SSWL MANY sem zeTndod jsoul eyZ 3nq ‘SLOW pue sWLSY o70M&#13;
peuotyususucTun yong *suotun peysTTqejiss seyj fo suo uT sTeuotssejorzd HbutpTtnq zoyF uotjestuebz0 pue AqtTjUepTt Huozas e&#13;
HuTYSsTTqeyss JO AnoAezy uT sem TeAeMoOY uotutdo bututeum —-T8A0 SUL “UOTINFTISUT STUY UT AZNOGqe WZUuHNOAq eq oO SzEM ehueyo TeVuUSeuepuNZ JT seToT seaogqe seyy uo seyeq 03 Apog&#13;
eTGTssod e se WAIN peuotTjueu sqyuepuodsez Jo zequmu y&#13;
*ssoTsJJO ubtsep HutpTtnq ut Fyeys petzeltes TTe Hutjuesezdar uoTtjestuebio eTTeazqum euo ojuUT Jyeqjs yzoddns ateyR pue sTeuotssejord ey} TTe zeyj,eHo 3 Hutbutaq Fo eept eyj sem&#13;
quUSUIOS UCUMIOD e ‘sizequiewl uUOTUN HUTISTXe Jo esed 9Yy UT&#13;
“sqZodeqTYOAe YooFFe YOTYM SONssT TTe ssnostp o} pue AOTTod jZusewuuzeAch souentTjut 09 ,dnozb eaznssezd, e se joe 03 UuoTUN e JO pesu ey} Mes sqUSpuOodsez Jo zequmuU e 33TNd&#13;
“sqoeqTyore petTzetes oj} 4YTyeueq AeTNOTAZed Jo eq pTnom sty3 3T8F SZuUepuodses AueW *SWTeTO uMO ATSeYUR SeyeU OF YOTYM UO uoTFeULTOFJUT pue SsoUEepPTJUOD ssefAoTduie sath ptnom Azostnduiod jou&#13;
ybnoyzTe ‘SSeUuTTEepTNS esey, cweyj z03 ubtedureo 'ATRUueAzOduUT 7SOuU pue SUCTepUSeUMIODSA eYeUl pue eANjonNzAAS pue sTeaeT Azetes Yyorzeeset PTNOM uoTuN e ZeyR 4Tezx Auew eToOsnu Tetzysnput&#13;
HuTzzexs Jo WTFSeueq ey OF se peptToOSepuN ezeM sulos YbnoyAtW&#13;
&#13;
 *uoTuN eperz e AO UOTANATISUT Teuotssejozd e 0} AeyjTeu pebuoTeq %&gt;Gz pue dTysrzequew vay&#13;
peuwteTO %/1°29 eoTqoerd ejeaATid ut squepucdsez sy} 30&#13;
SNOLLVITIAAV&#13;
“ODIVN UT pequeseidez 270990q S}SeTERUT TeEUOTIOSS ATEeYR Ses OF PSEYSsTM 4Nq&#13;
AATAOUANY TeOOT&#13;
*oTdures ou} UT pepnTouT ezemM poeAoTduie-jJTes eyz pue sr0jOeATP stedtoutad ‘szeujzied se zeyHty eq pTNoM 7030es e7ZeATIAd syuy UT&#13;
ebequsorzed ey 'ASAeMOH =*UOTUN eperzzZ e OF pehuoTeq szeeuTbue uetoTuyoe JO %z7E pue sxAseuTHuse peze_zTeYyo JO KOZ&#13;
Zoqoes ezeATszd eyj UI *z0RDeS OTTQnd eYyy UT UoTUN SpezR e OF pehuoteq srzseutbuse UCTOTUYOS, Jo -%Gg pue srssuTbhbuse pezeqzeyo&#13;
Tle FO BLL ‘suot3anqzTysul HSutzseutbug_ Jo TTounop sy 70; qno petazeo Aeaans LL6T SUR UI *sdnozb Teuotsseyorzd rz3y70 aulos YRTM dtyszequeul uoTUN JO uosTAeduiodD e szezZjZO TZ STAeL&#13;
*sozemuos pue Azysnput ey7eatad ut %eg pue 7009S otTqnd ey UT UOTUN espera e of BHBuoteq %G°og eTTUM ‘%se ST uoTun e&#13;
5utyzoddns ehbejqueozed ey '%E*L OF SzZOSERTYoOre soTtTzoOeId ejeatsd Hbuowe dtyszequieuu pesesrzoUuT ue smoys Oz e1qeL FO&#13;
stsATeue uy ‘uotun pestubooez onL e oF BuTbuotTeq aot zoe1d eqzeatid ut %z azepun ysnf Jo eHequseozed e pemoys 7eUL *dtyszequeu uoTtun uo sjzoeqyTYyoOAe peTzejTes Ao; uotTysenb&#13;
© POPNTOUT owTZ AsATZ Sy AOF ‘'SLET JO ASAANS WAU SUL&#13;
yons se uoTzestuoTUTN oF pesoddo jou ezeM peTFsTyesstp eseuz go AueWw “*SsAeOTJFO YuSwuuASACH TeooT Fo soperzb [Te sjueseidez yoTYyM UuOTUN ey — ODTIVN YFTM uoT IOeFSTWIesstTp FO sem pesserzdxe ueqjo 4soul META BYR SszOeRTYOTZe Huowe mou wzou eyy&#13;
ST UoT}esTUOTUN ezZEeYyM sqZoeqTYyorAe AQTAoYyANe TedOCT Huouww&#13;
*qonpucD yo epoo Teuotssezorzd ATSeYyR UTM&#13;
&#13;
 OSLL OSOL&#13;
O€8L O80ZL&#13;
O9E9 O009¢G&#13;
6Z6T S8L6T&#13;
STTRI7eENH z0dd nN&#13;
O00SG 000s&#13;
OSO9 6G€¢&#13;
OOLG O007&#13;
6Z6T S8L6T}]&#13;
STTAAeNH IBMOT&#13;
OSS9&#13;
OOL9&#13;
OS9S&#13;
€2LS&#13;
L609&#13;
O€TS&#13;
quSsuUTeAOD TeooT&#13;
%OOT&#13;
v°s 8°TT&#13;
0°6&#13;
o°6&#13;
0809 699¢&#13;
soe 7Tyoly TTW&#13;
SsozASuMIOD /AzASNput S7eATId&#13;
6Z6T UO BLET]&#13;
SsesrTOUL&#13;
% Yo&#13;
SLET 8ZET&#13;
(F)&#13;
sbupuzeg ueTpEH&#13;
eoT IOeIAd SzeATIG&#13;
quewhoT dug&#13;
oO oT 3O PTeta&#13;
V eTqeL&#13;
8° c*e&#13;
Z9UI0 uoT zeONpy,&#13;
€°€T&#13;
spzeog TeucTieN pue jJUuSeUUTSAOD TezQUED&#13;
8°6Z 9°6T&#13;
:&#13;
petzeTes - sdTIOerg sTedtoutzd sotqoerzq&#13;
sReATIg ejeatzg&#13;
0*6z %&#13;
SoyTAOUANY Teo.oOT&#13;
G eTqeL&#13;
(Valu 802n0S) SL6T NI GiIgIa LINAWATGWH AG SLOULIHOWW JO NOLLNGIUMLstIa&#13;
6Z46T PUP SLET YOM CISIA LNAWAOTAWH Aad NOLLVYSWANEY SLOALIHOUW,&#13;
&#13;
 aZis HOlAdAAOLLOOWUd&#13;
dNowuS wqSv anv&#13;
ALVAIUd NI NOLLWYSWANTY&#13;
SLOPLInOUw&#13;
O1 00S 00zS O0nr&#13;
W OSOL on OO8ZL&#13;
0€S9 OvOS&#13;
0089 OzSS + TOT&#13;
O1 OSLS WwW OOTL on 7998&#13;
OzSS 00SP&#13;
OT} 0009 87Z9¢ W O8STL 0879 on} o098 LZve&#13;
O8zs OSes 0099&#13;
00SP 000g OOPS&#13;
OS - 92 SZ - IT&#13;
OT W on&#13;
0909 OOES&#13;
0S99 0009 OvOS OOOL 0099 00Ss&#13;
O1 W on&#13;
OOES OOLP 0007 OSL9 OOES OStP OSSL 0009 00SS&#13;
OT - 9&#13;
OT W on&#13;
080g OO€P Ov9E G68¢ 0006 SLIP OOLL OS6S 009%&#13;
S$ -T&#13;
+05&#13;
_ _&#13;
67-07 6€-O€ of a&#13;
SOTITIO "6 sate&#13;
00€9 0089&#13;
OSOg&#13;
00S OOT-TS&#13;
00ST&#13;
L eTqed,&#13;
OT&#13;
W 0809&#13;
OOL9 ETS9 SELL OOSL OSzg €T98&#13;
0OSS OS7P&#13;
0909 S8Lv | sjZOeRTYOAW OOL9 OOPS TIw&#13;
on&#13;
OT 00SS W OSs9 on OSLL&#13;
GLOL SZTL L8ELS&#13;
0Sog8 Osrs OSP9&#13;
S798 SLL8 0069 OOLS e7eATIg&#13;
OT 0S09 W OOL9 on O€SZL&#13;
EOL9 LT99 S68S SEL?&#13;
O1 OOLb Ww 0S9S on O09€9&#13;
oO8gs OS6S 000S 0089 0669 Ov6S 0008 L@vs 0099&#13;
OOT?&#13;
OSLYP&#13;
OSZsS Sotoer&#13;
S66L S8LL SLd9 9T88 67248 LELY&#13;
ZETS ARTz0yzny 0009 TeooT&#13;
_ _ cn PTeta TTIW +05 60-07 6€-O€ 0 juewko dug&#13;
DOS SOTOUMIOD S9z@S /AASNPUL&#13;
SzeATIg&#13;
9 STQeL&#13;
QTaila LINGWAOTdWaA CNW GOV Ad NOILVYSWANEY SLOELIHOUW&#13;
&#13;
 80SS 0OO00S O09% O00S O0@% 680% OSE ODODE STTFIAeNH ASMOT SvV6S SVZS LTSS 8S%S O¢C6h SEY SSGLE ODE ueTpen cveo9 OLLG OST9 8S7S 0095S O000S OSZ% OD9E STTIz7eNO szeddn&#13;
646T S8L6T 6L6T B8LE6T E6L6T BSLET G6LET 8LET OG 6v - OP 6€ — O€ o€ Nn&#13;
TT STAeL 6L6T PUe SLOT NOFA ADV Ad NOILVYAWNNAY SLNVLISISSY TWHNLOALIHOUV&#13;
OS¢c?&#13;
_ tiv&#13;
VLIE OSGE clOV OOTV 80GS OSLP&#13;
ARTAOYANY eoTIOeId TeooT SeqZeATId&#13;
OTTAAeNH AEMOT ue TpeW eTTAIzeno zeddg&#13;
OT eTae, 6Z6T CIeId LNEWAOTAWa Ad NOLILVYAWANGA SLNWVLSISSY TWHNLOSLIHOUw&#13;
cELvY OOEV OOSH O8TF OOH ODTR 9552 EVTZ STTAACENO ASMO'T O¢vVS OOTS O8¢S O8Lh OSLH O07 OOSE LEEZ ueTpeNW 0909 Vv97S OOLS O8%7S O002S 009% SHZF OSE STTIzeno sz0ddn 6Z46T S8L6T G6L6T B8ZLET 6LET&#13;
B8ZL6T 6L6T 8ZLET +0 67 - OP 6€ — O€ Oc Oo&#13;
6 e1qeL 6Z6T PUue BLET YOA AOW Ad NOLLVYAWNNEY SNVIOINHOEL TWENLOALIHOUwv&#13;
&#13;
 OCCUPATION ARCHITECT&#13;
EMPLOYMENT FIELD&#13;
ARCHITECTURAL TECHNICIAN&#13;
PRIVATE PRACTICE 5.0&#13;
LOCAL AUTHORITY 0,0 0.0 9.1 90.9 ~ 48.4 45.4 7.2 i8.5 2.8 PRIVATE INDUSTRY/COMMERCE|} 25.0 - pe 25.0 73.9 - 7737 = 20.9 250 - - 0.0 8.4&#13;
ARCHITECTURAL ASSISTANTS&#13;
PRIVATE PRACTICE&#13;
LOCAL AUTHORITY&#13;
PRIVATE INDUSTRY/COMMERCE 10.0&#13;
PRIVATE PRACTICE all Under 30 age group 30 - 39&#13;
40 - 49&#13;
12.0 22.7 0.4 21.4 77.4 0.8 | 78.0 19.6 2.0 . 0.4 | 7.0 8.7. 39.7 44.6&#13;
50 +&#13;
LOCAL AUTHORITY&#13;
—&#13;
1.6—&#13;
PRIVATE INDUSTRY/COMMERCE|! 37.0 570} - 30.0 69.0 1.0 | 63.0 34.8 2.2 _ | 2.2 11.1 66.7 20.0&#13;
tH&#13;
On oO&#13;
aiew&#13;
0.3 1.6&#13;
22.2 73.0 362&#13;
9.8 34.5 54.9 0.8 f#1.0&#13;
0.7 93.2 5.1&#13;
6.7 0.8 27.7 0.0 o.1 11.) a2 10.0&#13;
70.6 0.8 93.2 5.9 0.8 - }aa.4 4.0 12.8 71.8 88.8 - 33.3: 39.4 24,2 3.3 f:14.2 2.0 42.8. 40.8 88.8 - 62.5 26.4 Oo.1 ~ t 0.0 9.9 39.8 51.2&#13;
4&#13;
; +Bfry : tblof t Bay Bl ‘ wyOo}&#13;
troH! ayo iy oF CH&#13;
oPRRAg aBo OS ® Qu o&#13;
ad2&#13;
I&#13;
i 87.0 13.0&#13;
vou eey&#13;
.&#13;
75.0 21.0 72.0. 24.0 63.0. 731.0&#13;
.&#13;
1.0 17.0 82.0 - 89.0 7.0 2.0 1.0 I 9.3 15.5 38.1 37.1 65.7 22.8&#13;
.t&#13;
AJ/TASS RIBA| (30 31-35 36-40 40&gt; | &lt;20 21-25 26-30 31&gt; | , | ‘Know&#13;
Number of Hours&#13;
Number of Days&#13;
QB Ay&#13;
.&#13;
cE peo wapaa &gt; 4&#13;
ud SH aKr&lt;o aa&#13;
gO Poh BA z&#13;
ad= UD 3&#13;
Ha] 4 Bia&#13;
&lt;CHg&#13;
Q hy«o2Ov, a&#13;
a oe qs | ba&#13;
do esacg wo&#13;
5a He&#13;
BSB"&#13;
RHOk j Be&#13;
a5ane Cw Q|8z&#13;
gS a ae5&#13;
4 w ob a&#13;
4K-9&#13;
9 ——54 He&#13;
|8P myoF&#13;
oF By 5 rd ea 53&#13;
Hi -4&#13;
Fe a&#13;
5:=&#13;
3&amp; ia d&#13;
ts&#13;
4.&#13;
a&#13;
2&#13;
0&#13;
-:&#13;
-’&#13;
|‘&#13;
\&lt;10 '11-20!'20+;Z Don't:&#13;
1&#13;
HH&gt; YPWHRHHYD ©&#13;
po&#13;
75.0 16.6 |&#13;
dHoO:&#13;
H wm&#13;
&#13;
 &#13;
 OCCUPATION ARCHITECT&#13;
PRIVATE&#13;
PRACTICE all&#13;
2.9&#13;
79,0&#13;
18.1 3.3 79.0&#13;
17.1 97.9&#13;
1.3 0.8&#13;
65.5 25.2&#13;
7.8 0.0&#13;
2.0&#13;
Under 30 age group&#13;
30 - 39 \&#13;
40 - 49&#13;
50+ , ‘|&#13;
LOCAL AUTHORITY ap&#13;
PRIVATE INDUSTRY/COMMERCE| 1-0 58.7 40.3 1.0 58.7 @2.3}78.0 21.0 1.0 4.4 77.8 11.2&#13;
7.6 49.6&#13;
42.8 €.7 “52.1&#13;
22.2 | 70.5&#13;
16.4 13.1&#13;
10.8 0.0 0.0&#13;
ARCHITECTURAL PRIVATE PRACTICE 3.0 85.7 11.2 6.1 83.8 19.1 |89.0 8.0 3.0 63.0 20.0 13.0 0.0 2.0} TECHNICIAN LOCAL AUTHORITY 3.1 80.9 16.0 3.0' 84.0 13.0 87.0 10.2 2.8 3.0 0.0 0.0 97.6 0.0|&#13;
PRIVATE INDUSTRY/COMMERCE | 3,3 66.7- 30.0 4.5 70.5 25.0 |90.2 8.1 1.7 25.0 41.7&#13;
. : 33.30.0 0.0&#13;
fl&#13;
ARCHITECTURAL PRIVATE PRACTICE 1 7.0 85.1 7.9 7.0 75.2 7.8} 91.5 2.5 5.9 75.0 14.6 5.2 0.0&#13;
ASSISTANTS&#13;
LOCAL AUTHORITY 1 5.7 71.4 22.8 2.8 85.7 11.4 }86.6 6.6 6.6 2.7 0.0 0.0 94.4 5.2&#13;
PRIVATE INDUSTRY/COMMERCE| 13.3 53.4 33.3 13.0 54.0 33.C |89.0 9.0 2.0&#13;
2.7 48.0 20.2 0.0 3.8}.&#13;
-&#13;
&lt;a 4 4&gt; f&#13;
Notice fromEmployer Notice fromEmpioyem min, mess Know an&#13;
Contract © Pub other in &amp; top annuation&#13;
,a o.&#13;
eats e Bae|&#13;
OUD c} ago) \‘ Seas|Be&#13;
ah. ag&#13;
Ne *&#13;
wa 7 Bec 3?&#13;
HO ~ on ~ a4&#13;
MC&#13;
2A -&#13;
‘ nEe733Be 4&#13;
‘ot Ma&#13;
won a ~|w&#13;
ae&#13;
: .&#13;
ogg 9 a&#13;
ze&#13;
28.0&#13;
&lt;4 4 / 4 |. Stat. Stat. Don't] Contract out Contract super-&#13;
-&#13;
Qa g Be&#13;
rasa &amp; Cis fi&#13;
a 0 Ba&#13;
u eK&#13;
mo Bu&#13;
og 42Q pe&#13;
ag fi&#13;
re dg&#13;
, ae 0G&#13;
Ba Q&amp;&#13;
CH OZ&#13;
a&#13;
Be&#13;
U0&#13;
wd mS&#13;
Q&#13;
0&#13;
ai is BR&#13;
|: it:&#13;
. Bg vnu&#13;
87.5 1.7 0.0 6.6&#13;
83 ai&#13;
YP&#13;
EMPLOYMENT FIELD&#13;
&#13;
 NOILWdNO90 AG SNOILVSINVDYO&#13;
“(TaId LNAWAOTAWa Ad CNW&#13;
0°79 0°02 O°O€ 0°0€ O°€Ee O°6E&#13;
+TOT OOT-TS 0S-92 S2-TT&#13;
OT-9 S-T&#13;
S°0TFJFO JO Szts&#13;
O°Ss&#13;
0°08 0°94 0° OF&#13;
z°T9&#13;
0°sSs&#13;
O°rL 0°9G&#13;
E°SS&#13;
O°LS o°L9&#13;
O°LL&#13;
O°8SE ANOART UL&#13;
squeySstsse&#13;
TeanzoszTYyOIAe TIwv SorSuNUYdD&#13;
/AASNPUL S7eATIAg AyTA0yANY Ted0T&#13;
SoOTAOeAg Szeatiag’:&#13;
suetuyosaL&#13;
TeaznzoeATYyOAW TIv SOASUMUOD&#13;
/AAASNPUL SAeATIG AQTzoy;Ny TesoyT&#13;
SoTAIOeIg&#13;
S4eATIAg&#13;
JO SNOILVITIa@av&#13;
JO SDWLNHOUEa FHL&#13;
sjUeIsSTSsy&#13;
- [TeanypoeztTyoay&#13;
ueTOTUTYOsSL Teanzoeyryolay&#13;
spoeqTyorze TIV SoASUMUOD&#13;
/AAASNPUL FUSUTIATSAOH&#13;
S7eATIAg TerzUSED&#13;
ARTA0yANY&#13;
Ted0T&#13;
TTW e0TOeIg&#13;
PTSTA yZUSUAOCTAuURy&#13;
SQeatiag&#13;
7odeATYOIY uoTRZeaNSdSO&#13;
6T STCeL&#13;
6°E? 0°69 6°17 Z°6&#13;
O°TT 0°02&#13;
ALIYOHLAY TYOOT LNWLSISSY HOLILOved ALVAIYd| IWanLoaLrTouw&#13;
O°EZ O°Ees O°E9 9*¢&#13;
O° LP? 6°72Z&#13;
ALIYOHLAY TWOOT HOLLOVed ALVAIYd&#13;
NWIOINHOSL | IWYNLOSLInOuw&#13;
S°6 ©" 6E LY G°0O8&#13;
6°99 7°TL L°L9&#13;
BOUAWNOO/AMLSNANI aALVALad ALIMOHLNY TWOOT aOLLOVdd SLVALUd&#13;
O°SZ ees&#13;
LOULIHOUY&#13;
Suo&#13;
eUuUOTSSOTOZ "Saxe tadorddy&#13;
quseuA0T Gurg&#13;
uotun N OperzL&#13;
UCTArnaSury : .&#13;
PTIOTaz :&#13;
uotaedn&#13;
Fo 720&#13;
Og eTIeL&#13;
(SsoTzoerd SejeATid UT SoTsIO JO ozts AQ pue) CGiala LNAWAOTdWa AG GNW NOTLVdNDD0 AG SNOINN dO UNOAVA NL SowLNaOudd&#13;
&#13;
 out UT OO”7'’SF Fe ASeYIO YOes HutTTenbe uetpewu&#13;
ebe TEepTO ey UT senuUT&#13;
uetotuyoe, AZTz0yANe&#13;
UT SsMOZZeU SOUSATSTITP SUL “SEO’TF St 3 ‘QuewkTdwe ARtzo0yAne&#13;
TedoT sy uaTM dnobz&#13;
ebe 6E O12 O€ SUR&#13;
TROOT UT seszsUM Ege’eF ST S,0€ AOpun |yR AOZ SoTIoerd eqeatad ut sbuTuzes uetpew eyL °*€z STqeL UT uMOYS ST STUL “*saOqDeS oTTqnd pue ejzeatid ey ueemjeq Azea shutTurese uetpeu ATpeqoedxq&#13;
SainoHy&#13;
SOURPMOTTWY APO pue Saeo ONGWATGWH JO SNOILIGNOS&#13;
uoT}ezSeuNUIeEY Pue SoUSTTSdxy&#13;
*dnorih efe OG zeACO&#13;
syy yATM dnoz6 UCD puSszy o"UL “P7e'’ Ps Ae 68TH Aq peeue&#13;
UOT eATSUnUSY PUe PTET jUSUAO TCU&#13;
O@p'SF 03 shutTuzese uetpoul dnozb she 4YsepToO ey&#13;
ue peAsTtTyoe suetotuyos, JeTTeus pemoys sdnoz6&#13;
out UT OSL'PF 02 “BT°ET Aq pue 626T Atenuel uT COG'EF OF Meet Aq peseeiouTt O€ ASepun esoyR AoOZ sHhutuzes uetpew ezeym&#13;
sdnoib fe ASMOT OMA&#13;
3ZseHhrzeT OM su °dnoz6 ATeptm Aq peseezouT&#13;
suetotuyoe7 jo shuturzee /&#13;
ebequeored HbutAzea&#13;
ut %z°9 Jo eseezDUT&#13;
UT STTUM Ogz'SF O3 %S°OT&#13;
‘dnoz6 ebe 6% 03 OP&#13;
zepTo om eyz *dnoz6&#13;
eBe 6¢E 07 OF&#13;
SY UT Oo10M SoseeZOUT&#13;
abe o7 Hutpzooc0e sebequeorzed&#13;
"6STqeL oes ue ATUO seM oezeUA&#13;
JO SseezoUT SUR UT *SOSeoAOUT&#13;
ueTpoSUu ALL NOILVaANNWHaA SNVIOINHOaGL&#13;
SNVIOINHOGL TVWYNLOELIHONV&#13;
“a070eS S7eATId Sy UT UeYR Ssanoy GE pUe TE USseMIEeq y¥IOM sueTOTUYDER AXTZoyANe TeooT ezow AT3YyStTTs ‘peyrzeu Area jou ore SPTeETsZ&#13;
queuxoTduis usemMjeq sesoueTeTITp ey Ubnouatw *fT STaeL UT uMOUS se YSem red sxnoy OP pue 9E USeMqIeq YOM sueTOTUYDEA AsO TTezTEAO&#13;
*suetTotuyos ARTZ0YANe TeodoT Huoure uoumiod rsouU oze SOOUeMOTTeE eheeTTW 7eD *ATyeueq sTyy UTM peptaAord eze 20R30eSs OTTQnd eyy UT&#13;
zequnu JUPOTITUHTSUT Ue STTYM 7Zed e© YATM peptaorzd %G AZeao 3snl UFTM 20R08S SjeATId 9|yR FO Saznjzeey e suTeWeET osn eZeATad&#13;
pue sseutsnqd zA0F Zed e FO UOTSsTAOAd 9|yA 'sRoSEATYOTe UTM sy&#13;
*“sqZoeqTyore Huowe Zuezesstp ATpeyzew st YOTUM puerzy e - ATqertepTsuocd smozzeu siojOes OMA 93YyA USsEMIEG sbutuzes uetpew ut&#13;
SsouseresITp ey ‘Aqz0F Jo ohe syRz ASeAZW “STQesotzou st Hutyeed&#13;
Tenpezb azeTTwts e sdnoz6h ehbe AsMOT SYR UT ZOQDES OTTQnd ey UT azeyupbty eze shutuzes uetpeu sy3 ybnourtTy “*dnozb eHe og zeAo 9yR uT senbeeTToo Teuotsseyorzd zateyy ueyz re3eT ATAUSTTs syeod pueTenpez6 st she 03 Hutpzo0d0e shutures UeTpSeUl UT SseeTOUT SUL *sdnoz6h she AZeMOT Om} SYA UT ez70M Otdues |yR UT zZSequMU yZSeRZeeErTH SUL&#13;
*“ebe Jo szeeA O¢€ ASpuN orem oTdues ey Jo %o°sp *sdnoxzb ebe eseyz UT sueTOTUYDeR FO zAequMU ebrzeT ey H5utzoeTyez ‘sdnoi5 efe 4SseMOT OM} 8YR UT 7ZseyuhHty sem esuodsez sy 3eyQ sMOUS&#13;
€ pue "Z ‘T seTqeL °zpz sem suetotuyoe3 worzy surmnzez JO zequnu euUL “Spell sq ued suosTazeduiod ou os ‘suetotuyoe7 TeanqoseyzTyoze A0F WusuAoTdue Fo suot3Tpuos pue sHhutuzee&#13;
jo AsArNs sATsusyerduiod e puTZ of eTQtssod useq you sey ALT&#13;
&#13;
 pSjUeASTsse Teanqoeqtyorze eTatTssod useq Jou sey 4T&#13;
*jZueuAoTdus Jo suoTyTpucD pue Aed&#13;
jo AsAaans eATsueyerduiod sueTOTUYDeA TeAznZoeATYoOTe&#13;
SLNVLSISSW IvVunloaLIHouw&#13;
SNOLTLVI TIAA&#13;
* (ZeA0 Sy UT eAze ANOAeZ uT ehbejusozed&#13;
TTeus Area eYyR UT eTe ANOART&#13;
pue TOT) seoTFFJO AZsebszAelT ysebzeT eyy pue (G-T) seoTJFJO&#13;
uT ebejqusozed YseTTeus HuTpzo000e suoTuN of sepnitjaje&#13;
ezeATisd UT ANoAeZ UT Sere HuTAznoaey sOTATAoyANe TeooT&#13;
OTTQnd eyy uT st eHejusozed FFFEeUSq FO eq pTNom uotun&#13;
sueTOTUYOS; [Te FO %GG&#13;
AZseyHty eyuA ATqeqAtTaAeut&#13;
e Fo dtyszequew yey&#13;
cweyy of zyHnoyW&#13;
eu 03 5uotTeq ssefoTdwue&#13;
UI “°(8T STQSL Ses)&#13;
pezoeszquodD eAeY CUM “%QIT 3eU&#13;
*sweyos uotjenuuerzsedns otTTqnd&#13;
“OT&#13;
eyy 073 HSuojtTeq Aytazofeu&#13;
ouleyos uoctTsued ejeqs oTseq&#13;
yesez6H oyA AoOjoSs SeEATIG SUOTSUeg&#13;
SABST YOTS Pted&#13;
eyj 7eYyR SMOYS SOTIJFJO JO&#13;
JO umopyeerzq yw *eoTjoOerd&#13;
Ky Hutstadans e ‘teaemoH&#13;
ut seeXhoTdus %9/ UTM rORDeS&#13;
eu sTeeaez ETSTqeL&#13;
SNOINN OL SHCNLILLY&#13;
TTe ATzeeu AORDES OTTqnd&#13;
'reyQeHoqTe suweyos eqeas pue ‘osuwsyos ejeqs eyz&#13;
%TT UTM&#13;
sXep QZ ueyi sseT Ssaey oUuM ZO QDeS e7eatad“(VT STAeL Ses).&#13;
pesoddo se Aepttoy seyuy ut %¢g OF skep gz 03 Tz Aoluse mou seeAotTdue r07DesS&#13;
OTTqnd yo AjtazofLew eyL *srz0jDes oma oy usSeMjeq ASTXe OF SNUTAUOD sSsouerzeJITpP STQerSepTsuod yeyqj mMoys satnsez Aoaans ous&#13;
e puTJ oF YIM sy&#13;
go stsATeue uy&#13;
ey suq FO Ano dn doq szeXoTduse&#13;
ezts of&#13;
*suoTuN&#13;
Sy ULI&#13;
SACPT LOH&#13;
uoTyned os ‘eTdues ey Jo %6°97 SestadwoDs coum sdnozb ehe ZEMOT OM SYA wWozAZ useq seu ssuodse z qZsehzeT ay ‘utesy&#13;
‘dnoz6 ebe zeybty syz Az0zF sajtnsez eyQ uT pesseidxe eq ysnu&#13;
“zey;TeEUu OF HbuTSuoTeq “%T°TT uyFM uotTun oper, e&amp; OF HuotTeq %e°e¢g STTYM UOTANATASUT TeUOTSsSezozd&#13;
e 03 HuojTseq %9°9z pue sueTOTUYyoeR AATAOYANe TeosoT Hhuouy *“zeyjtTeu of HuThbuojTeq %6°e9 YATM UOTUN Sperq e OF %/°9 pue UOTAINFITISUT TeuCTSsezorzd Wey OF HhuojTeq %G°zEe eotjzoead&#13;
e7eATId ul “*suotun epezqz AO suOoTANATAZSUT TeUCTSsezord TSUATS JO suetTotTuyosez Fo dtyszequisu syz sMous Oz STGeL&#13;
“ZUSUSTITIUS SAPSeT YOTS pted Aue Fo ezeMeUN STEM AORDES STU} UT sjUepUucCdsez AueU Ang ‘'UOUMIOD ere YRUOW SUO ANoOGe JO spoTzed 2030es eR2eATIAd Ssyy UT STTYM 'RORTQUOD SIR ut pezeqs ATzeeTO pue peustT{qeqse ATWATJ pue uouMOD ore&#13;
Szo0ul AO syyUOU g9 FO spoTAzsd 20R0es OTTQnd sy UI “*SsAeeT pted jo yQbueT Fo 4eyR St CT STqe_ UT uMOUS se szrOjDeS OM SYA UseMjoeq SouezeZJTpP OTseq su “*seaeeT yots pted&#13;
sAep 0% AeAO SATSOSEAT suUeTOTUYDeQ aya JTeyU AAO AsNyp&#13;
&#13;
 UT ST°TT UTM pezeduiod squejstsse sotqoeid eqeatad&#13;
SACPTTOH&#13;
*quewAoTduse AAytTzoyAne TedsoTt&#13;
STqdeL “sanoy ewes sy}&#13;
TeRSOT FO %8°SS STTYUM&#13;
MZOM (%9°OL) SOTQOeAd&#13;
ARTA0yANe TeooT Huouwre&#13;
OTTqnd eyj UT SeTqesotjou e7zeatid uT %OT pue zojOes&#13;
S47 ST SSN SjZeATId pue&#13;
Aytazoyjne OF USEeMaAeq go AAtzoLeu eyy&#13;
Ssainoy&#13;
°seoAoTduie SbeeTtu ze9&#13;
*Z030eS pue ATZSNput Fo ehbeTtatsd&#13;
03 HutpzoD0e squejsTsse&#13;
pue Tenpez6 st ofe Jo shutTuzee ueTpeu UT SSeSAOUT SUL&#13;
uoT}eTSUNUEY Pue SOUSTASUXY&#13;
sanoy GE pue TE useMzEq&#13;
Jo ehejueozed ZebzeT © 2eUR SMOUS ET&#13;
YOM sjUeySsTsse TerznjoeqtTyorze 'Yoom Zed sanoy OP pue&#13;
sQZeATAd ut squejstsse&#13;
uoumioo 3sou ST ssoueMOTTe&#13;
OU ST 4T STTYUM SeozeuMIOD&#13;
Sjeatad suR UT %L°9 sseuTsnq ATOJ zed e FO&#13;
umoys se ‘'dnozb she zeA0o pue Og ey UT syeed “TT STQeL Ut&#13;
*potied sures sy AeA0 O76’ PF OF 7°ET JO SSePSeTOUT Ue Sem orEYyR dnozb she 6¢€ O73 OF SU ACT SePOTSUM&#13;
"6L6T Azenuer ut 9G/'EF 02 BET Aaenuep UT OOP'’EF worz %Q°g Aq esort shuTuzes uetpeu ‘dnoz6 efe o¢ szepun eu3 UI °*%e°6 Aq dn&#13;
FUSM XEpUL SOTAgd [TTejeUu ey potszed stya Hutazanq “PET Azenuec 03 dn azesh ey UT %E°ET pue %G usemzeq Aq peseezDUT sey dnoz6 efe 03 Hutpzoooe squejstsse jo sHutuzee uertpeu suzy&#13;
“TT&#13;
SAPCST MOTS pted&#13;
YIOM (%L°LZ)&#13;
uoTstTaAord syy SOURMOTTY 2eD pue sized&#13;
LNEWAOTIWH JO SNOLLIANOD&#13;
328M Ady SACST YOTS pted FO potszed yeymM of ezeMe JOU e70M szUeASTSSe SOT IOeAId ejZeATtad Jo &amp; 2eYyR SsMOUS CT STIL&#13;
*sXep Jo zequmu owes sy ezeUS jUOEU -AoTdue AyTzA0yANe TeooT ut %e°ce ATuo STTyM (sAep ct ATuo&#13;
uotzzOdord eTqereptsuos e pue) zeeK e sKkep oz ueyi sseT oaecy (%7°€6) SRUeISTSSe SOTIOeId ejeaTtad go AqtzoLeu zeerhH ous *e0TIZOeAd eRzeATId UT g*o ATUO 02 pereduiod ‘zePeA we Aept Tou sKep o€ 03 97 Aolue sjueastsse AqTA0YANe TedCT Jo zeqzenb&#13;
e ATAPON “PT STAUCL UT umoys st se QueweTatjue Aepttoy UT STORIES OMA SY} USEMIoeq FSTXS SSoUsSTeTJTIP eTqereptTsuog&#13;
“OT STGe} SSG *r0RDeS OTTQnd eYR UT zEQ' PF pUS COT’ HE ST quUeISTsse TeanjoseztTyore sotyzoerzd sjeatid eyy AOF uetpew sy&#13;
“sqoejzTyore pue suetotTuyoe} TerznqzoeqTyore YATM se AZOJOSes oQeATId pue oTTqnd eyj Usemyeq yonu se Azea jou op sHhutuzes ueTpEW&#13;
uOTZeAZSUnUSY Pue PTeTaA jUSWACTCug&#13;
NOILVYENNWaY SLNVLSISSY TVaNLOALIHOUW *szeok 0G rteA0 Ssoyy ATTetToedse&#13;
&#13;
 -eL&#13;
Ssozeumiod pue AAZSsNpuT sjueystsse AjTzoy4Ne TeooT&#13;
*s0TzOeAd sjzeatad ut %97 ATuo pue&#13;
sjeATzd ut %0g ATM ‘ZNoAeT Jo &amp; ZeAQ *suUOTUN FO&#13;
UT SA9M SRUeISTSse TerAnjoseAtTYyoOAe&#13;
dihsasanan CQNY SNOINN OL SdaniLiILiv&#13;
UT ezEM ANOAeT TTe FO JTey Teao asnp&#13;
‘SUOTSUSeg&#13;
"(ssw~ ATTensn) uoTun sepezq e of pebuoteq eotjOeId SezeATad ut %6 ATuo eTTYyM (ODTWN ATTensn) uotun epezy e oF pefuotTeq sqjueystsse Jo %69 juUewAOTduS ARTAoyANe TeooT ul&#13;
"03 pebhuoTeq sjueqstsse Jo %p°~E YOTYUM OF Ssueyos uoT}enuUeredns oOTTGQnd umo AaTeyA eaey AATAOYRZNe Ted07 *yno HuT}oerWUOD %O°HT YITM ouleyos uotsued eje4s oTseq&#13;
S47 03 pebuocTeq sotzoezd ejzeatid ut &amp; 3eUR SsMoUS BT STaeL&#13;
“(S0TAZesS JO potzed uodn Hbutpuedep ‘ezow 20 syjuoU 9 ATTeultou) saeet pted skep ezouw 20 OZ FO 4TyJOueq oy peU t03708S OTTQnd UT %g°zy STTYUM (YQuOU e ATTewxzou) sAep oezoul ro 0z&#13;
O32 PETITIUS Se798eM soTIOeAd SjeATtad ut %g°zT Atuo *SOTAZES OTTGnd ut juUSueoTpezd sures ey pezeys %g°oP STTYM 'peTyTIAue&#13;
&#13;
 sHutuzes uetpoew ey3 dnoz6B&#13;
“OVT ‘pF peyorez ebe 6% 02 OP ety UT eTTYM ‘dnoizb abe&#13;
SeM UeTpPEeUI&#13;
OoOor’eF sem ueTpSU SUL&#13;
"%T°6L ST 3T ‘'203D0eS&#13;
OTTqnd ey SASM K%B° TZ&#13;
SNOINN&#13;
‘dnozpb obe&#13;
“008'PpF sem ueTpeW SUL&#13;
°“ZOL'9F sem sHutTuzes uetpeuw oeyz yotym zoF ZSAO pue OG SYR UT Siem sqUSpUCdsez |eyR Jo AsOW&#13;
STOFeAZSTUTUpPe PUES SSTAeJS708sS STeU TTe zOzZ sHhuTures&#13;
6€ OF O€ SUF UT OS8’'EF OF PeseszDUT YOTYUM OOE' EF eyuy dnoz6 efe o¢ AzSepun |syuRz urT °6/6T Aaenuec ut Ssz07zez74STuUTUpe pue sSsTAejsAOSs STeuley [Te AOF sHutTurzese&#13;
UT STTYM uoTUN seperzz e 03 HhuoTeq %e*g z04Des SqeaTad eyR urT&#13;
*uotTun e&amp; FO ANoOAeT UT SASM SAORZeASTUTWpe pue setazeqzerzoes [Te Fo %6°T9 jZUSeUAOTdUeS ATAOUANe TeDOT UT STTYUM azAnoAeZ UT&#13;
ZojxoSs SReATIAd Ssyi Ul °%6°ZH SEM Wey YTJeueq pTNom uotun e zyHnoyy OYM szORZeARSTUTUpe pUe seTAeJeATDeS TTe Jo ebejusozed sus&#13;
NOILVYENNWEaA SUOLVULSINIWGW/SHIYVLAYOTS&#13;
&#13;
 *uUOTANATASUL&#13;
T? SToeL GOVLINGONdd VW SV&#13;
ejetadorzdde ey} JO suznqez eTqeTtTeae asejetT uo&#13;
peseq st Asaang suotqnqtysul Hutzeeutbuy zoz TtTounog (Zz)&#13;
Z°T6&#13;
szeeutbug Tedtotuny&#13;
O°eD&#13;
S7oe RTyoszy TeAen SreeuTbuyg TeoOTzrAAOeT, szseuTbug TeoOTueyoey&#13;
Z°0S T°Op&#13;
0°0P L°62&#13;
SzseuThbuq [TATO&#13;
Je 4stThbsy ywnouw uo peseq ‘st Aesaans wary (T)&#13;
EeOb&#13;
S°og SPOOR TYOIAY ZODSS OTTaQNg&#13;
: eT&#13;
. sdeqTYyolW eee SoTOeAG |eReATIg&#13;
(z)846T&#13;
eamns Igd Aeaans valu Aseaans sswl/cw&#13;
(T)8L6T SL6T&#13;
Gassadudxa dIHSusaWaW NOINN 43O SNOISSH40Ud UFHLO HLIM NOSIUWdWOO&#13;
srzseutTbuq Teazanzoenz3g&#13;
&#13;
 JO uoTJerSuMUSIT SATSequIEU&#13;
S8e9&#13;
799s OOL9&#13;
OS9G OSSG&#13;
OSLS 00S9&#13;
TSL&lt;S&#13;
G69S 66729&#13;
                        ESGL&#13;
                        osog&#13;
                        OSzg&#13;
OOSZL&#13;
6L6T Azenuel AST uo sHutuzeq uetpew&#13;
*uUOTAINATASUT SeqeTadoadde sy&#13;
"(SZ6T SunfG) AsAANS WEIN uo peseg » *ASAINS SSVL/CW UO peseq ¢&#13;
FO peyOnpuoo sAeaans&#13;
USWUATSACH Ted07T&#13;
ee ee Sot IoOeId eReATIAa&#13;
WUSWUATSAOH TedoT&#13;
petszetes SOT IOPId STeATIG&#13;
uo peseg fT&#13;
SsoeqTYyoOrAW y:&#13;
geoesPeay 7 BTOASAINS&#13;
zo toteuT asa 7SteDeUEH sqo0e73U0D&#13;
2b1ueby/SaaBeUeN e4TS 2sz0Kkearng ZoTues 2br07eu ea ZOTues&#13;
-7 eeeH&#13;
,Sa2eureug TeotueyooyW 7S7eeuTbug TeOTAROSTT&#13;
qeteres TTATO uotzedns009&#13;
s}oerUOD&#13;
7ACTUES&#13;
“(JFeIS 66P7-0G7Z) Sr0RDeIQUOD peZTts- untpeu Aq peAoTduis Teuuoszed Aey Jo sHhutuzes ue Tpeul&#13;
o7UT 3TUN SssUuTsng SutptTting Aq pejzonpuos Asaazns uo peseq Z&#13;
*NOISHd DNIGTINd NI NOlLWdnooO Ad NOTLVUANONGY AALLWYVdNOD&#13;
&#13;
 %&#13;
\&#13;
(od sSrawira vom} Gib) pody SoySIES proUNURHet Wo paseg&#13;
88SE S6SE CO9E PPLE OOTP?&#13;
3STUOCTIdedSsy euoydete, ‘ysTdkz Kdop Sszeimnogey Sutpting ‘ssejzew sueusazesz5 3STGAL yrETO sqstdaz pueyzaz0us&#13;
STT7 v9ICT CSF SLEPT&#13;
SOT IOADS¢g szeAeTyotszg&#13;
SLOP VELP S8TS&#13;
SAISYeupooy usus yubnezq&#13;
S6TS&#13;
Hutzseutbuq - uswuer0g szeyoeey Azeutizg&#13;
OvES&#13;
szeyoray, Arepuosas sjueqUNODOY SISUTW TROD peuTezy eoeg Sszsuuexrborgq zeynduoo ‘sqsAtTeuy suejsdg&#13;
S8Ss&#13;
SO9S OZLS&#13;
9L8S TVT9&#13;
SRJUBAZSS TTATD z0Tues OTUOTAOOTHE/TeOTsAAOSTY_ -— szseurbuyg uot zeoONpY, zey,Ang ‘sasyoreyz&#13;
LEES ST69&#13;
S2I80TFISO AQezes eaty ‘gz0j0edsur SOTTO FFEIS OTwWepeoy Aqtszeatuyg&#13;
8802 =&#13;
UsWSIT I STSYIOM SACFTOM SZSATIAG spoon Anarsy&#13;
eanneeneeR&#13;
“SdNOUD. TwNOTLWano00 UaHLO HLIM NOILVWYSWANGY JO SISATWNY TALLWIWaWOO&#13;
&#13;
 sy} JO shuTuzes jo&#13;
peerzds oyq eqeotput&#13;
AzeA pue ‘'AsaTns eze YOTUM soTzeTes&#13;
Aeyy "que zzodut Aq peuzes ATTenzoe&#13;
*eTdosed oz eyq yo&#13;
‘suetpeu ’zreAemoy jou ST YOTyM&#13;
eaznhTtzZ e yatm dn ueyy pue ‘seTzeTes&#13;
pues TTem Aeuw suo OZ seyej suo JT&#13;
'eHezoae eu 4yNO 'pespur *yaTOM PeATWTT&#13;
ST uOoSeez puOodes&#13;
ZO ATUO ST eznbtz&#13;
eHezene ue ey&#13;
OuUL&#13;
S49 ST 4FSTT 2no umop Syuj pue ‘STT ano umop&#13;
Su ST AT ‘Aes 03 AzeTes eq PTNOM eTTAzenb&#13;
éSeindtyz yons satb Aum&#13;
"SeTTqazenb AeMOT&#13;
*sTdues sui ut etTdosed&#13;
Oy UT sTenptatput&#13;
ere ‘'soeTtjzenb pue&#13;
Aue Aq poeuzee ATTenqoe&#13;
Aem sy JO szeqaenb Aem ayy FO zeqzenb&#13;
ST ReEUL “*HuTYyUeZT&#13;
zeddn eyr ‘SOUTT owes&#13;
"FFeORS TeANZ9SR FYOzTZe OF ATtzeutad ATyeem setdoo 000’'€z Fnoqe sTTes pue '*paq sserzg Teaznzoeqtyoszy eyy Aq peysttqnd st Teuranop szoeq4TyoAy SUL&#13;
- Sswi&#13;
- £V&#13;
sezyR Azetes suo Azetes ano UT OZ zequmU&#13;
98 Huoty é8[TT3IeNG© ST 3eUM&#13;
cueTpen © ST 4euM ATAMNS&#13;
syTOMm&#13;
*eTTIzZenb zeddn eyq ut sAemte oze sesAoTdus atTeyz FO jSsow WeYyR eznsue oj AoTTod Tewz0z ITeyA 37 syeu Aew soetueduiod suios ‘uoseexz styq 10g *ssoutsng&#13;
JO SUTT STY UT pTed 4seq sy Hhuouwe Apeerzte ‘TTe zeqaze ‘ST 8H “ysed JO suosesz r0zZ Auedwod reyjoue 07 peyduse; eq 03 ATeyxTTUN sT oy vey ‘uCTssezozd zeTnoTjzed sty TOF eTtyzenb zsddn sy3 ut AzeTes e Hutateosez st uoszed e JT 3euR sqsTTetoeds Touuoszed Huouwe jJetteq ptey ATeptm e st ezsUL&#13;
“suo TeoTjOeId e ST YSATZ eSUuL “suoseer UTeUI OMA OTe OO,&#13;
“erTyspz0sz2eH ‘Aoysng 'peod PTSTIUHTH Gz&#13;
‘uoTR0SS Sszzeis ‘ubtseq Hbutpring ssw many Aq peusttqna&#13;
“MOTSq oe Srey se (OV) UeTpew eq eAOge seTzeTes AueU se ooze e7ey} ‘SPIOM 7SeYyAIO UI °,UeTpeU eyy,ST AzeTes AsTpP eyA ueUa ‘FSVT FSOMOT |] pue ysaTyz AzeTes yseuhty eu yATM ‘Zepz0&#13;
Hutpusosep ut eseyj ehuerze em JI *seAoTdue yo AzobezeoD utTeqzzeD e 20F pejzonb soetzeles juSeTeTJTP Tg eze ozeyR Aes sn yoq&#13;
*Z0Rz0es AzeRZUNTOA 8yR AZO ‘'sDzSuNMIOD pue AzZsnput ‘setoue “4TNSsuooS UT FSYyVZSYM***eeeree"s*HhutuuetTd pue BbutzssutHue ‘Hut -Aesamns 'SaanzoeqyTyoIe UT SeOTIJJO AoOWOes SszeAtad ut peAotdurr&#13;
eTdoed TTe roy uotun 9yA st sswL Fo uoTzOSeS szyeqs ubtseq HuTpTting euL *srzeyr70M Hutzseutbug Fo uotun pezeuwebTeuy eu ‘uoTUN FsebzeT puodes sS,UTeITIg JO UOTIOSS APTTOO aATYM&#13;
eu} ST uoTIOes Arzostazedng ‘SeaTIeAYSsTUTUpY ‘TeoTUYDeZ eUL&#13;
&#13;
 dtyusizequisu uoTUN eper} UT erOM 3G°Og SOS qTYyoOAe AATAoyANe TeooT buouwy "SSWZ~L ut AQZtTzoCew syj - sAZequew uoTUN MoU eze Bers STTUM&#13;
‘WaIY Of HBuoTeq szoOeRTYyoZe ejeaTad Jo sazeqazenb sezyR ASpuy&#13;
SUOTIETTTSFV pue sdtTysrequey *sqZOe4TYyorZe AATAoyANe TeosoT Huouwe op g//&#13;
STTyM ‘uoTuN e ANOAeF MOU SZOSeATYOAe&#13;
SOT AOeAd a4eaTAd Fo gee&#13;
suoTun&#13;
*oueyos uoTtT}enuezedns szt OF HhuotTeq rz0Rz0eSs OTTqQnd&#13;
oyu ut AqytTzoLew jeezbh sya STtTym&#13;
ATUO YFIM suSyosS uoTsued ajzeqs&#13;
eotzoerd ejeatad go ARtazolew syy *seotqzoead ejeatad ut&#13;
esou} ueyi spotaed zebhuot Aey wory&#13;
au} UT esoya ATTezSsueH “SsAeaeT YOTS&#13;
eTeMe JOU SAeM SjuUepUcdseA FO ASqumu&#13;
‘Ano Hutyjoerzy4uods Azeazenb e oTseq oy 03 HuoTed sqoeq4TyoIe&#13;
peytyoueq z0jDes otTTqQnd pted of JueweTATIJUS ATEeUA JO&#13;
shazezt ATSbutstadans w ‘sot OeAd szeatad ut gz ATuO eTtum zeeK e skep oE€ 02 92&#13;
butAoCuse sesAoTdue AATAoyANe TedsoT Asou yATM ‘sao DES OM} SY USsEeMJeq JUSUISTATJUS AepTTOY UT 4STXe seTOUSeTEeIFp&#13;
STqezeptsuojD “*siznoy OF pue 9F€ USseMIEeq&#13;
jZuewAOTduy JO SUOTITpPUOD&#13;
*pueTeAI ASyRAON pue uopuoyT uT&#13;
sueTpow yseySty ey UTM WACFTuUN&#13;
03 ButpzoD0e sjoeqTYyoAe AATAoYANe Teoso,T AOF sHhuturzes uetpey&#13;
*seoTgsO Fo dnoazb ysebazelT pue 4seTTews eyj usemjieq OQQGTZ AeAO&#13;
yoeor shuturzes uetpew ut seouezeyztp SOTFFO 9YyF FO SZTS 93YyR ST SdOTRIOeAd&#13;
dnoxz6 efe eTpptw ey ezeym&#13;
SsjeaTad ut uoTWZereumuUeT Fo STSAST SzOSFFE YOTUM SOTFIO JO-uCTRZeOOT UeYW AOAOeZ AeQeeTh YW&#13;
"0029 03 30°6 Aq BsSOozr sHhutTuzese uetpeu soe ATYyoIe&#13;
AATAOYINY TeOOCT ETTYUM 0G9G3&#13;
IToey HbutseerouT szoeqQTYyoOAe sot joerAd eyjeatad yAzIM ‘sptTety&#13;
queuAOTdus UseMzeq SUOTIETACA&#13;
Aq 9sot Xepur SoTIgq [Tejey ey USyM UTR &amp; Ae ‘08095 OF&#13;
STQeTSpTsuOo sTOeM STOYL °3E°S 3p°g Aq peseezoUuT soe ATYOTe peTazelTes [Te AO0J shutuzes uetpew UOTAZeEASUMNUSY&#13;
YIOM sjoSATYyoIe AsOW&#13;
ezOW |oAze UOTReOOT pue SeztTs&#13;
03 37°6 Aq sHhuTuZeS ueTpeU&#13;
SNOILIGNOO CNV AYVIVS =: SLOYLIHOYV Sitnsoy Asaans Jo ATeuums&#13;
qe ean eee eam ea ea eam oan a ens&#13;
&#13;
 SdTySTequew pue SUOTIETTISIV&#13;
(eoTIOeArd e7eATad UT 39h pue SeTRTAOYANe TedOCT UT 391) Weyz OF 4TySeuEq eB eq PTNOM UoTUN eB SsASTTEeq sueTOTUYDeA TIe FO FTeYy TS8AO&#13;
07 dnozbe e6e Asepto&#13;
ey az0F peseezouTt&#13;
suotun&#13;
SUOTITPUOD&#13;
“OCVSS stTenpearb Atuo&#13;
uoT}eTOUMNUSY&#13;
“uoTun sper} e OF HuoTeq FTeu e TSAO STTUM UOTIeTOOSSe Teuotssezoad e of buotTeq zeqjzenb e ATuo suetotuyose, ARZTzroyANe&#13;
TeooT Hbuowe eTTYyM uoTuN epezq e&amp; OF g/°9 pUe uoTzeTOOSSe Teuotsseyoid e oF HuoltTeq eg°*ze aotroead ea3eaAtid ut&#13;
*yno HuTJoerQuOO ggT ATuO YATM suEYos eqeqs OTseq ay OF BuoTeq 70RDes sQeatad ayA uT sueTOTUYyoe 4soW &lt;‘shep Qz ueu} SSeT eAeYy OYUM TORZDSeS |ReATId |UA UT g¢Eg 03 pesoddo&#13;
se Aepttoy skep gz 03 tz Aolus seedoTdue z0oj0es oTTqnd so AytzoCey “*saznoy op pue g¢ UseM{eq YAIOM sueTOTUYDS ASOW&#13;
pue 08¢S3 07 SS°OT JO sseezTDUT Ue peASTYOeS sueTOTUYDeR dnoz6 o6e 6P-oF eu UI ‘dnozh abe ¢6¢ 03 O€ SUA UT OSLPSZ&#13;
OF $T°eT Aq pue 6/61 Aaenuepr UT QOSGEZ OF PeseeToUT sey dnozb ebe o¢ ASepun sy Az0Z sHhutuzese UueTpPSU dU,&#13;
INQ QIQUOQUGN QUQAUIGI&#13;
*sdnoib abe Tep[O ey UT 3no pseusAS SSeT TO erou pue sdnozb ehe AemMoT ey} UT peyTeW ASOW ozeM Zo}ZO8S |SjzeATAd pue oTTqnd syj usemjzeq seToUuSeZeTITG&#13;
SNOITLIGNOD GNV AYVIVS : SNVIOINHOSL ITWHNLOALIHOUW&#13;
~~}&#13;
&#13;
 UseMjeq UOT}eASUMUST UT SoUeTeTITP eseorOUT Ue SEM |z78YyR dnozh&#13;
suotug&#13;
SUOTITPUOD&#13;
*SZTORZOSeS OMA 3YA AST [Tews yonw e sem orsdUL&#13;
“OC673 OF SZ°ET FO oefe 6¢€-OE SUA UT SeezZEUM&#13;
uOTReASUMUSY SNOLTLIGNOD GNV AYVIVS =: SINVLSISSV TWHNLOALIHOUV&#13;
“SOT ATzouANe TeOOT Su UT $69 ASAO YATM UOTUN eperz e 03 HuoTeq sotjZoOerd ejeatad ut yqueqa ke AZepuN jasnp&#13;
*eoTQOeId sjeATad UT 297 UATM ANOAeCF UT ereM SjUeIASTSSe ARTAoyANe TeooT FO sxzeqzenb sezyA AeAQ *suUOTUN Jo ANOART&#13;
UT S419eM SJUeRSTSSe TeANIOSRTYOAe TTe FO FTey Aeao 3Asne&#13;
"Jno but joez4uoo gg°PT ATUT YUATM sUleYyoOS oqeqs OTSeq eu} OF HuoTeq szue4stsse soTJOerd ejeatad Fo sazeqaenb sezur ‘uTeby °qjusewXoTdue ARZTAOYANe TeoOT UT patyR e ATUO 0&#13;
pezeduos Aept{Toy skep QZ Aepun saey soTWOeAd aReatad ut sjuejstsse jsoWm “ATYSemM SAnoy OP pue 9F USseMAeq YIOM ASOW&#13;
6L61 Azenuep ut 9g/,¢E3 03 3g°g Aq |sor abe Jo saeak gg aepun sjueqstsse [TeanjzosqtTyorze FO shuTuzes uetpeu sug&#13;
&#13;
 "3no pejzUutod eq TTT sAeaazns omy&#13;
SUA USEeMzeq SssouszeFFJTp *pezeduiod eze sqoeqtTyore&#13;
ejeatid ysnf usym peyzew “sqoeqTyoze Tso’T JO eTdutes&#13;
ssetT st sotdures UT SoUSeZeTITP e uo peseq st ASarns ssuL/Cw&#13;
SyL&#13;
ouL&#13;
eu FO sseAoTdue TTe&#13;
Asarzns eatsueyerduos&#13;
S3T JO sASAANS paeTWTT&#13;
JO suctTyZTpuooD pue setzetTes&#13;
UST3TIAg FO UOTAINATIsSuL&#13;
HutseezouT sumsse 03 3ZsezeqjUuT Jo eHansdn ue&#13;
TeAoY Sy STTYM *eoUeyrOdUIT&#13;
eTqejou ‘Asaazns styW&#13;
AATz0YUANe TedOoT pue eoTtzoOerd&#13;
“SPpTSTF jZueuAoTduUS TTe UT syZOSeqTYOTe peTxetes gg6’T FO eTdues e pey g/6T eUNL UT Ano peTazzeo ASAaNS WHIM B/LET SUL&#13;
*sqZoeatTyorze AATAoYWZNe TeooT pue soTjoOerd sjeatad suzeouos se AtTTetoedse sAeaans&#13;
OM SYA USeEMzZeq Speuwl eq UeD SUOCSTAedUOD peTTeIep sulos&#13;
FeuR smMoUs I STqeL “SL6T UT eTdwes waru eya Fo %0°6z pestaduiod oyM eoT}OeId eqeatad ut stTedtoutad SepnToxe&#13;
ezozezey pue ‘Azysnput ubtsep Hbutpttnq eyy ut ssoAoTdus je&#13;
ATTeotstoeds pue ATTeuotjuequt peute st ‘°e*T ‘suotytpuoco pue&#13;
seTzeqTes seutuexe Asarns SsvL/fv eu eu ST szOSeATYOAZe 03&#13;
pzebexz YATM sAeaans&#13;
omy oy usemqeq SouezessItp&#13;
Azewtad sys&#13;
°I eTqeL ut umoys st umopyeerzq yw ‘peptaord ezem suanjez eTaqesn&#13;
sjuspuodsez ey Jo&#13;
(768‘'T) OM AQZouTU pUue pezpuUNY AYyHtTe ‘puesnouz suO ‘uotize&#13;
-oTTQnd suo uo SutATexr&#13;
pue ezTeuotysenb petteriep&#13;
e e4Tdseq&#13;
eTdosd op suot3tTpuos&#13;
pue ssoTsjo usemjzeq ‘Ssz0RZD9es&#13;
e useq zAeAeu sey ez90uW usyeqrepun sey (WdIU)&#13;
jo ‘'sazequisw UMO szoOeRTYOAW&#13;
ATSeXTT eze AsyR pue&#13;
useq sey ezeyq zeek ased&#13;
SONSsT Oesoy UT eu UI&#13;
ézepun YAOM&#13;
Azea wes} ubtsep Hbutpttnq&#13;
Fo puTy 3eUuM ESSUTTAUTOSTp&#13;
‘wes uUbtsep HutTpTtng&#13;
useMzeq ejzeATIAd pue OTTQnd useMmizeq eyy utTYyATM SOTzeTes Op Moy&#13;
ynoySnoszyyz&#13;
NOTTONGOMLNT.&#13;
‘SSOTSYURASASN “UOCTINeD WTM pejzeezq eq PTNoUS s4tTNsez eUuA os&#13;
suanjez Jo zequnu [Tews e ATuUO sem ezsy, — suotssezoird ubtsep butpTtnq zeyz0o ATqejou ysow - suotiednos0 euos ut&#13;
“suanjezt eTqesn o47'€ ‘'SL6T ut Bbutptaosd (%0L pue 09 USeMZeq) esuodsez yHtTy e eAeTtyoe sAoaans esod&#13;
SUL “aZe4SsTbez (MNDUV) WophuTy peatun eyA Fo Trounos; uoTzeAzISTbey szoseyTYyoOAy Sy WorZ pe AoetTes eTdures SATI&#13;
uT SuoO eB UO peseq sT pue UoTIOSS sOTISTIeIS WaIU eUuR Aq peyonpuods st sTyuL *sbhutTuzeg pue jusewAoTduy ,sjzoeqTYyoAYW go Asaans WaIUu ey. UATM suostTaeduicd sulos Hhutyew yyrom ST 3T 'sZDeRTYOZe STEM squepUCdsez Jo dno2zh ZsebrzeT eu. sv&#13;
*“ATsnhooueyTNuts suotieottqnd Tezeaes ut SeazTeuotysenb ey ysttTqnd 03 szeeX eznyng ut pedoy st at&#13;
‘TSMOMOH *STASPUNOULANSUT Sq OF UOTSedDD0 sTYyR UO peAord suotssejoid ubtsep SutpTtnq zeyjo of petTtTe suotzeottqnd&#13;
AOYIO OFUT SATeuoTZSsenb oyy HutyZzesuT FO setTA[TNOTIITp ous “Teusznor ,szoe Tyorzy ey Jo ATUO enssT suo ORUT peqZesUT seM&#13;
(xTpuedde sy UT peonpozdez st yotym) uodnoos ATdez ptedjsod e YATM zeyRZeEboI ‘ezteuotysenb ey, ‘enbtun ezojsezeyy st - Teusnor ,sq_oSRTYyYoOAW ey puUe SsvL ey JO uoTIZOeg UbTSEeg&#13;
Butptting eyz Aq pezosuods AtAjutTol ysatz euy —~ Asarns STUL&#13;
&#13;
 qZueuyzZedeq pue SUOTINITISUL *“SOT3STIeISs JuewAOTduY Fo HutzseutTbug_ zo; Ttounoy seyW Aq&#13;
peyonpuod syTnsez Asarzns sy uo peseq Spew st suotssezyord ubtsep Hutpttnqg eyR usemjzeq uosTizeduods peTte,ep e 'zeaomoy&#13;
eeee *7pzUuoD&#13;
*sbutputz Aeaans o9y3 uT PepNToOUT st stsAtTeue ue&#13;
&#13;
 9599 886T 87S&#13;
(ATuUO sjd.eqTYOAYW&#13;
petzertes) Asaans Waly&#13;
T2T&#13;
%8° LE SOV %6° TV 097&#13;
ZeyzO pue uoTWeONpY ‘uoTjzetoossy Hbutsnoy&#13;
/AQTAOUANY UATePSH&#13;
SsoASUMUIOD /KAASNPUL |VeATtszdg&#13;
ZOWDeS OTTQNg&#13;
SOT OeITd szeATIAd SLOALIHOUY&#13;
T eTqeL HIdNWS 4AO SISATVYNY&#13;
9E 68 vst&#13;
8c LS LUT&#13;
cLYy 7° TT&#13;
6TT %0°6 G6&#13;
O9T O€T&#13;
6SZ&#13;
cre&#13;
TeIOL&#13;
SUdHLO GNY FAWLS DLwYoddns&#13;
S'TIVNOISSHAOUd NOISHA ONICIING UFHLO&#13;
ZI5U20 ZORDES OTTQNd SOT OeRAgG SReATIG&#13;
SLNVLSISSY IVYNLOALIHOU&#13;
ZEeU30 ZOADEeS OTTAGN eoTIOeId |eReATIAd&#13;
TSOT ASAANS SSVL/CW&#13;
SNVIOINHOEL&#13;
TWANLOPLIHOUuy&#13;
&#13;
 “SENWLSISSW TWUNLOZLIHOMW&#13;
aA? =&#13;
Z°6 T&#13;
T "ez&#13;
6°2Zz&#13;
9°9z&#13;
| Ov | ZTZAO&#13;
8°“08&#13;
65°91&#13;
O°.LL&#13;
PyEeL&#13;
| ennOr |&#13;
Zo jDeS OTTand&#13;
zo z0es |] zo qDe¢ eaqzeatid fl ottang&#13;
z03D0¢ |} z030e¢ e7eatid || OTT¢nd&#13;
zojz0e¢g {&gt; dnoz5 sqeataza| aby&#13;
SNWIDINHOSL TWANLOZLIHOUY&#13;
SLOALIHOU&#13;
«| ovze Z°Sz | 6°z9 ete&#13;
|&#13;
|&#13;
€ eTqEz, NOILVdNOSO GNVY CISId LINAWAOTdWH AG SUVHA OF UBGNN BAOWLNAOWSa a&#13;
TWHNLOELIHOUW&#13;
IN ~&#13;
8°S PET 9°CE Z°Lb&#13;
0°6 0°9 L°ot POT 7°S2 6°67 S*Ts. L°LP&#13;
€°OT T°LT €°OT S*0z 8°Sz 6°97 O°LP | S°ST -&#13;
L°s S*6T PoP peuz&#13;
+0 6P-OP 6E-0¢&#13;
68&#13;
|&#13;
vett | L9&#13;
Letot|fl =so7 {&#13;
oopv| etToaazoess %OOT&#13;
%OOT&#13;
LOOT %OOT&#13;
xyoot |i soot&#13;
|TwengoSLTBOUY&#13;
SLOGLIHOTY&#13;
203085 edTROeAZG || zojDeg = so TADeAg | Z0zDeS edTIOeIg oTTang eqeatiadfl ottana eyeatadj] OtTana — eqeatza&#13;
aby |}&#13;
Z eTqer NODTLVdNOoO GNW CISIG LNEWAOTdWA AG NOLLNGIULSIG FOw AHL&#13;
oft oo a |&#13;
</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="39">
            <name>Creator</name>
            <description>An entity primarily responsible for making the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2035">
                <text>AJ/TASS</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="48">
            <name>Source</name>
            <description>A related resource from which the described resource is derived</description>
            <elementTextContainer>
              <elementText elementTextId="2036">
                <text>John Allan</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="40">
            <name>Date</name>
            <description>A point or period of time associated with an event in the lifecycle of the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2037">
                <text>1979/80</text>
              </elementText>
            </elementTextContainer>
          </element>
        </elementContainer>
      </elementSet>
    </elementSetContainer>
  </item>
  <item itemId="368" public="1" featured="0">
    <fileContainer>
      <file fileId="384">
        <src>https://nam.maydayrooms.org/files/original/5cb733b7e4d795d95e3787baaf7aa036.pdf</src>
        <authentication>e56ba8edf33fca092d83233e840aa2d2</authentication>
      </file>
    </fileContainer>
    <collection collectionId="7">
      <elementSetContainer>
        <elementSet elementSetId="1">
          <name>Dublin Core</name>
          <description>The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/.</description>
          <elementContainer>
            <element elementId="50">
              <name>Title</name>
              <description>A name given to the resource</description>
              <elementTextContainer>
                <elementText elementTextId="13">
                  <text>Trade Unions and Architecture</text>
                </elementText>
              </elementTextContainer>
            </element>
            <element elementId="41">
              <name>Description</name>
              <description>An account of the resource</description>
              <elementTextContainer>
                <elementText elementTextId="14">
                  <text>Themes included action on asbestos and Health &amp;amp; Safety, and involvement with Direct Labour Organisations and Building Unions. Following comparative research of possible options, NAM encouraged unionisation of building design staffs within the private sector, negotiating the establishment of a dedicated section within TASS. Though recruitment was modest the campaign identified many of the issues around terms of employment and industrial relations that underpin the processes of architectural production.</text>
                </elementText>
              </elementTextContainer>
            </element>
          </elementContainer>
        </elementSet>
      </elementSetContainer>
    </collection>
    <elementSetContainer>
      <elementSet elementSetId="1">
        <name>Dublin Core</name>
        <description>The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/.</description>
        <elementContainer>
          <element elementId="50">
            <name>Title</name>
            <description>A name given to the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2038">
                <text>AJ/TASS Survey</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="49">
            <name>Subject</name>
            <description>The topic of the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2039">
                <text>Draft version/s of survey</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="41">
            <name>Description</name>
            <description>An account of the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2040">
                <text>ee&#13;
 4. INCOMES AND CONDITIONS OF EMPLOYMENT SURVEY&#13;
Ds NEXT MEETING(S)&#13;
6) Motion 7) &lt;A.O.B.&#13;
The incomes survey sponsored by T.A.S.S./B.D.S. which appeared in the AJ recently is to appear again in the magazine "Building" on March 16 and members are urged to draw this to the attention of Colleagues who did not complete the AJ form.However, it’s still not too late to do so, since collation of returns will now be&#13;
delayed until the appearance of the census in "Building".&#13;
With the results of the survey anticipated it is intended to&#13;
devote the next couple of meetings to discussions on pay and conditions of employment generally and a possible role for T.A.S.S./ B.D.S. in improving these in design offices. All members should make a special effort to attend to ensure the widest-possible&#13;
range of reported office experiences gives the most clear overall picture;&#13;
At the next branch meeting to be held on March 20 Mike Moxley,&#13;
S.A.G. member and one of six R.I.B.A. members who drew up the&#13;
recent R.I.B.A. approved contract of employment will open a discussion _ on its content and intentions.&#13;
March Branch Meeting : Tuesday 20 March at 6.30 p.m. (Promptly) in Polytechnic of Central London Union, 104-108 Bolsover street,&#13;
London W1.&#13;
AGENDA:&#13;
43 "Do Building Professionals need a contract of employment" A discussion to be opened by&#13;
Mike Moxley R.I.B.A&#13;
2) Office reports and discussion 3) Divisional Conference report. 4) N.A.C. report&#13;
i) Branch Officers! reports.&#13;
&#13;
 Building Design Staii&#13;
London Branch Secretary : 2B Oakhill Road, SW15 BRANCH BULLETIN - MARCH 1979&#13;
13 REPORT ON FEBRUARY BRANCH MEETING:&#13;
Following the January meetings' discussion on the Labour party's policy document, "Building Britain's Future", the February&#13;
meeting was held at the House of Commons to allow Bob Bean M.P. to give members a first hand account of the Labour Party's real intentions. A U.C.A.T.T. sponsored.M.P., directly involved in the preparation of the document, Bob Bean spoke at length on all the issues it concerned and not only the controversial question of possible nationalization of major contractors.&#13;
He implied however that nationalization was no real alternative&#13;
to employers "putting their own house in order" aver such issues&#13;
as safety standards and de-casualization of the industry. Indeed&#13;
he made it plain that, contrary to CABIN'S reports, there was no suggestion of widespread nationalization and that no labour government would ever adopt such a policy.&#13;
and” the . rmuleation--of.such.a polley.is.20 be the. subjecs,.of, future branch activity?&#13;
2s ARCUK ELECTIONS&#13;
Members will be pleased to learn that all six of its members who stood for election to the A.R.C.U.K. Council were successful&#13;
together with the Leeds T.A.S.S. member, Ian Todd. Though A.R.C.U.K. is at present a body representing mainly registered architects&#13;
it is in the interests of all building design staffs that their unions be represented on it.&#13;
3. N.A.C. MEMBERSHIP&#13;
There is now a vacancy on the T.A.S.S./BDS National Advisory Council and any branch member interested in filling this vacancy should contact the branch secretary.&#13;
He confessed that the document had been prepared without any&#13;
real involvement from the design side shortcoming was the subject of several&#13;
of the industry and this members questions. However&#13;
he welcomed advice from design staff&#13;
within the labour movement&#13;
The questions that followed indicated that many members, while welcoming much of the document, flet that the proposals were in some respects not radical enough. In particular some members felt that emphasis in the document on standardization&#13;
failed to use the example of direct labour organizations as a platform from which to build an alternative&#13;
stronger line on nationalization should&#13;
have been adopted.&#13;
was overstressed; that it&#13;
building industry and that a&#13;
&#13;
 FTAA, VowkeGinger&#13;
/F0.bop. Gy SqWea hoff6,&#13;
al)i)NHi iif PR }&#13;
{f&#13;
, |63 ah&#13;
=eo BAA ; Leth ad&#13;
te&#13;
retieDN aL:He 2{}¢&#13;
LL&#13;
Lei&#13;
cL MLS&#13;
EEALthyPhPT TDM)LaeATeie, |&#13;
&#13;
 The following motion was received by the Branch Secretary and has been&#13;
included on the Agenda in accordance with is listed here verbatim.&#13;
Before being discussed, Standing Order&#13;
Standing Order No. 16, and&#13;
be proposed and seconded by members If the motion is passed it will be Committee and the Divisional Council&#13;
No. 11 requires that motions at the meeting. &gt;&#13;
forwarded to the Executive for their consideration.&#13;
"This branch calls upon the Labour Government to pursue a policy towards the construction industry which :&#13;
4) Encourages worker participation and public accommtability in the running of the construction industry"&#13;
1) 2)&#13;
Ensures a continuity of work flow to the industry to provide stability of employment and training opportunities.&#13;
3)&#13;
Encourages the application of standards -of safety and performance in the design of buildings without restricting their flexibility or the visual variety of the built&#13;
Encourages the reintergration of the design and construction sides of the industry both in the process of awarding&#13;
and administrating contracts and in the education&#13;
background to the work forces.&#13;
environment,&#13;
This general meeting is called under the provisions of Rule 16e,&#13;
Should the quorum required for general meetings of the branch not&#13;
be in attendance the Branch Council may, if a quorum of the Branch Council is present, deal with the business down for consideration&#13;
by the branch general meeting, and if this course is decided upon, then those members of the Branch who were present for the General Meeting shall be co-opted for that business with full voting powers. Where any motions and amendments for the consideration of the Representative Council are passed by a Branch Council under the provisions of this rule a copy of the notice concerning the general meeting shall be forwarded by the Branch Secretary for the attention&#13;
of the Standing Orders Committee. The SOC shall not include on the agenda of the RC any such motion or amendment unless the notice calling the general meeting specifically stated the nature of the motion or the amendment. Similarly when the Branch Council&#13;
under the Provisions of this rule deals with the voting for Divisional President, DC Sec, EC or Dept.EC Member, Nat Womans Sub-Committee Rep, or NWSC Deputy Rep., a copy of the notice calling the general meeting shall be forwarded to the DC Secretary&#13;
together with the record of branch voting. If the notice of&#13;
meeting does not include this item of business the vote of the branch shall be disregarded by the Divisional Council.&#13;
&#13;
 tailects&#13;
Nor is the pvor architect Seaba? offwithhiscor-&#13;
chents&#13;
National to attract a higher than usual proportion of first-time theatre goers. For&#13;
newcomers to the National,&#13;
respohse' in:the Olivier audi-: torium where the design con- centrated on sight lines at the expense of the essential rapport between audience and actors. They describe the “Wimbledon” effect in the Lyttelton, -with a’ stage so wide in relation to ‘audi torium depth, that the audiences , are vigorously&#13;
exe fesine their neck muscles to follow the action. Averting their eyes from the inert back stage technology, they will take you to the tiny con- erete cells that serve as dressing rooms, set round a corrtyard so large that a visit&#13;
.» a colleague turns into a route march.&#13;
The actors’ complaints are&#13;
interminable; the audiences are less articulate. After all it is ‘the policy of the&#13;
tectural prize. Had the users been the judges “this elegant concrete addition to London's riverside skyline” would cer- tainly have got the wooden spoon. °&#13;
Actors and their audiences are its.main users. The actors deplore the time ,lag of&#13;
discreetly ¥ obscure signs, “the carefully hidden: ticket collection’ and informa-&#13;
tion points under claustro- ,Phobically low ceilings com-’ ‘pound the visual ‘confusion.&#13;
rape The best efs usually come from sé who build little and rey, ike muluiple retailers&#13;
67?&#13;
from.&#13;
mnoaate wi interest.&#13;
ft % y 16&#13;
rycatSe o—pisturebyDonMcPhee...&#13;
ALL&#13;
‘strained&#13;
fall out with our It isn't their fault. ve otter designers they are&#13;
better than their brief; uch ots usually abysmal. e trouble is that so few&#13;
us are competent do brief&#13;
apchitect, ; take houses. Most of' us d claim famuharity with&#13;
louse or two. But huw uy of us, have ‘actually it one, and have tried to&#13;
‘slate experience into a eo brief ? Remember “Mr gs builds his Dream "and how poor Mrs&#13;
dings added a flower Kk dn her porch and got&#13;
i! tor extras for $10,000? yway, dnost house building ry speculative builders and a! authorities whuse&#13;
eat) Hriefs demand wrence to standards, themselves but biting to creative Most of the time tu Copy something&#13;
can be good or nding on the made.&#13;
me Ome. )&#13;
i you oy aedga nee ofice at Grove&#13;
An architect is only as good as&#13;
or orewers. But unless build- ing itself is their business, even the most dynamic organisations are unlikeltyo need new factories or offices very often. Their skills in&#13;
ational HPs eive, The‘ build- ing, does look good from the top of an. Embankment bus;&#13;
briefing architects are bound bo grow rusty. Indeed, they often commit millions toe architecture with an insows! ciance which is totally incon- sistent with their usual hard- nosed control of their money, and which scares their pei: tect rigid.&#13;
going, «&#13;
-Bian Boylan,. an ‘ancliiiart&#13;
In this state of mind the architect needs a well- developed ego to draw a bow at a venture — choosing from and copying existing models is easier, and proba- ‘bly cheaper. But when the ‘building has no. models he is forced to thrash around for a brief, and too often designs to a set of generalised social and aesthetic considerations; which means designing: to please other archite Unfortunately he js encouraged this way, because the accolades (like those given to many professionals)- are awarded by his own kind — other architects.&#13;
ésigned an’ order office in CraWley; Surrey, for BOC, the company ‘that’ supplies gas cylinders’ for. welding. He too had, a generalised brief but luckily he discovered that the bat ing ‘was to be used: for&#13;
The National Theatre is a case in point. A large, expen- sive, one-off building, it has been awarded a major archi-&#13;
not: be set on the wood edge with . windows, and _ bird tables designed'to accom-&#13;
It may not win any architec-&#13;
What uot can do&#13;
‘all right if you pretae looking lat .townscapes _ ‘theatre-&#13;
deliberately unconstrained by quale ‘ations, récently&#13;
only 27: people. So he and his’:team ‘talked to all of them, ‘and at some length: not, their: representatives, or thejr. managers, but each and évery person.’ The ‘brief, in consequence, was- uniquely enriched and ‘particularised.&#13;
thing (except the lavatories) Kor ‘example, \they dis- happens in one open uncon- covered that’ for some years’ and much more&#13;
the; ‘loaders, -in.-the rest. useable space.&#13;
periods between humping There are many _ other heavy ‘gas cylinders, had details which a sympathetic&#13;
‘developed a. serious, interest company, its interested in studying the wild life in employees, and a -conse- :wood which bordered the quently, well-briefed architect&#13;
site. There was ‘no reason have managed to incorporate why the new building should into this satisfying building.&#13;
tural&#13;
prizes, but&#13;
it is an&#13;
Peter Gorb&#13;
on desi5gn '&#13;
where ahiey are, ,Suppose to’&#13;
To this is added the inescapa- ble cacophony of the: foyer performers and the. aifline terminal announcements. The poor first-time’ ‘visitor must long for the certitude of Pad- dington Station; or Milan Cathedral, lange ‘buildings designed with the needs |of the newcomer in mind.’ °'&#13;
that way. As aresult every-&#13;
It is disappointing. tdo, ‘to queue for a drink, and dis. cover that the nearest sand- wich is two foyer levels and another queue away. 'Or to try and reach the terrace tables with a trayful of food through an inn?&#13;
door. Not&#13;
much more&#13;
from the teriaccs&#13;
Of course the priority in. the design brief was fora national monument mr a&#13;
Opject lesson on how not to&#13;
his brief&#13;
fall outwith your architect. ‘‘&#13;
the building inside and out is a _ bewildering obstacle course of apparently unrelated levels reached dy Alice in Wonderland: stair- cases pointing away&#13;
ous created a glass-clad building the architect had to protect it from the gas ylinders which. have a habit of toppling over; prison like guard rails were discarded in favour of a sloping bank of grass which in any case. enhanced the rural nature of the pbuilding.&#13;
But perhaps the greatest breakthrough came at the organisational level. The expectation of local manage- ment was for a traditional building which reflected functional separation; offices from canteens, blue collar from white collar workers, and so forth: The inquiry revealed that the magnificent twenty seven didn't want it&#13;
</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="39">
            <name>Creator</name>
            <description>An entity primarily responsible for making the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2041">
                <text>NAM</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="48">
            <name>Source</name>
            <description>A related resource from which the described resource is derived</description>
            <elementTextContainer>
              <elementText elementTextId="2042">
                <text>John Allan</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="40">
            <name>Date</name>
            <description>A point or period of time associated with an event in the lifecycle of the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2043">
                <text>1979/80</text>
              </elementText>
            </elementTextContainer>
          </element>
        </elementContainer>
      </elementSet>
    </elementSetContainer>
  </item>
  <item itemId="369" public="1" featured="0">
    <fileContainer>
      <file fileId="385">
        <src>https://nam.maydayrooms.org/files/original/2219af360134d72f173903aa187808ae.pdf</src>
        <authentication>fe92e93b611aa1346320c392387b1959</authentication>
      </file>
    </fileContainer>
    <collection collectionId="7">
      <elementSetContainer>
        <elementSet elementSetId="1">
          <name>Dublin Core</name>
          <description>The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/.</description>
          <elementContainer>
            <element elementId="50">
              <name>Title</name>
              <description>A name given to the resource</description>
              <elementTextContainer>
                <elementText elementTextId="13">
                  <text>Trade Unions and Architecture</text>
                </elementText>
              </elementTextContainer>
            </element>
            <element elementId="41">
              <name>Description</name>
              <description>An account of the resource</description>
              <elementTextContainer>
                <elementText elementTextId="14">
                  <text>Themes included action on asbestos and Health &amp;amp; Safety, and involvement with Direct Labour Organisations and Building Unions. Following comparative research of possible options, NAM encouraged unionisation of building design staffs within the private sector, negotiating the establishment of a dedicated section within TASS. Though recruitment was modest the campaign identified many of the issues around terms of employment and industrial relations that underpin the processes of architectural production.</text>
                </elementText>
              </elementTextContainer>
            </element>
          </elementContainer>
        </elementSet>
      </elementSetContainer>
    </collection>
    <elementSetContainer>
      <elementSet elementSetId="1">
        <name>Dublin Core</name>
        <description>The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/.</description>
        <elementContainer>
          <element elementId="50">
            <name>Title</name>
            <description>A name given to the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2044">
                <text>Interior Perspective</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="49">
            <name>Subject</name>
            <description>The topic of the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2045">
                <text>NAM Survey of Salaried Employees in Architects'  &amp; Staff Offices (2 sides)</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="41">
            <name>Description</name>
            <description>An account of the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2046">
                <text> ‘G14H NOILISOd&#13;
*SSSYCOV ONV AWVN YNOA *SSSAYCGOV OGNV AWVN 301s40&#13;
SAALLOAdSH3d YHOIMSLNI&#13;
(Azyoeds) zeyyo (¥&#13;
*sep °ysnpurt (fF “sep oyuders (F&#13;
“Sue “yoo (F&#13;
eptaormd 0% ysta nok JT&#13;
‘3ivd&#13;
*AYV1VS&#13;
£perepTsuoco ATOEATPO@TTOO (09e sqytjord ‘sesuedxe Sspeeyzreao Jo uoTzONper feuTty 3to0ys)&#13;
*Bue °oeTe (q&#13;
S@CATRBUIOZTE Or0M SOs JI yseTOUBpuUNper 0%&#13;
(eoTzoead wory auooUT ssoz? [e703) azeuzzed rotues (p °yoa, pred ysemoT (q&#13;
eefoTdue pred yseuzty (0 TBOTreTO IO [Tenueu pred 4yseaoT S&#13;
saaAo0jduig (q) -&#13;
aotTad peytnsuo0o LTeATzZOeTIOO Fyeys eTEM °6&#13;
‘sue Areqyues (J&#13;
£8TS¥q ZBYA UO pues SgeTOUBPUNPSI [ENPTATpUT Wo pepToep om °g&#13;
“sep TOTIe4UT (oe “yore edwospuet (Pp&#13;
esreek ¢ 4SBT 94} UT quepunper epeu useq eaey jJyeys fuew aog °*)&#13;
Butuuetd umoq (0 °Hue °-onrzs (q “S78 (8&#13;
ZNIOM JO srnoy UAC ITeyy TEAO OABY JJB4s OP TorTZUOO YonM MAOH °9&#13;
suotsseyord pe,eley&#13;
éJJOou eyroypTedfeyery&#13;
£04 pezemooue fey4 ery (q&#13;
Kjfoeds) zreyzo (q et ae te&#13;
{S8esiMo0o esveTeI-fLEp IO /pue ‘saytezye uotun epery ‘sa0usreyu0O&#13;
TeotazeTo (F oe&#13;
‘gaInzO8T Toy JFO omy, eye, Jyuqs Ley (e °C g°ed 4023 nof op uoyyeowa skep Aue Aog °y é920a nok op yooa zed sanoy fuew aog °¢ 3302008 4dex soTIeTes TwnpTaTput ery °z&#13;
SUSTOTUYSSy @ UemsqysneIp (9 SzPOSFTYOIE Tay_ZO (q&#13;
‘&#13;
@&#13;
ony&#13;
3jO SeTreles eyeuTxordde ey4 eB yBYM °T&#13;
*gep ToTz94UT (q ‘yore edeospuet :&#13;
reayzo (TF Zutuueytd umoy (2 *Bue LrezTues (a *gue *yoom (0 "S70: (8&#13;
quawAo| dwg jO SUOIWFPUOD (D)&#13;
*Zue °oaTe (Pp *Zue °yonr4s f&#13;
E87U ST YUBOTFTUBTS mow (q £UNI BT BOTJJO ey, MOY yNnOGe&#13;
*sesn TTTeTnser soTsso ayy YOTYM SZUBZTNSUOD 9y4 sue aTwmes (q&#13;
pez[NsUCS FJBIs ey} ST SLBA YEA UT (B&#13;
°9&#13;
é(8)woTun YoTYA Toy ‘os JT (q&#13;
eTemes (4 eTeu (®&#13;
Z@07jJO 94 UT (PrTeMeys doys) ‘dex woTun eper4 e1om IO eUuO areq4 ST (®&#13;
°G&#13;
{ezeq} ere szeuyzed *yore Aue Mog&#13;
£93@ YIOM Jo suoTyTpuod ‘seTreTes BZuTreaoco zefotdwe ayy pue uoTUN epery, @ UeaM4aq&#13;
*sserppe pue emeu eat? ‘os JIT gWITJ Teyzoue Jo ATVTPTsqns © WITS ayy st&#13;
quomeerze Bupupesreq eaTZO@eT[OO &amp; e7ey, SI °P&#13;
*‘auo youe oj seefotdue [e404 *xoadde » ‘sserppe Seueu eat ‘sayouerq Teyy}O sey WATS JI&#13;
°¢&#13;
(248 Seugsse ZutTsnoy ‘fxrysnput eyeatad ‘Apog oTTqnd raeyyo *k4TIToyANe TeooT ‘Auedwoo *yore ‘dyyszeuyzed ‘aotqoerd yore *aTpuy ‘°3°e) ZeoTsyo ay, JO eInjon14s9 [VFeT ey} st zeyM&#13;
*qgeo0us ayeredes youyye esveTd ‘°04e UOT LBMIOJUT [BUOTITPpPS *sTyy xorex ysnf ro (peqepoerdde ado[Teaue passarppe pue pedwe2)&#13;
SSSIPPS SAOQB 9} WOT STQETTeAS ere seTdoo [VUCTATPPY “TT@eM sB eaTVOedsIeg TOTIEAUT ue eyaeTdwoo 04 seoTsJyo TeyyO UT spueTIyZ nok 4eB 03 ATL “TeT,UepTyUOO ATZOTIAAS Ydeyx eq [TTA woTytTsod pue eueu rnMox “eTqeuoTysenb suTeuer suoTsstuqns’ snoufuoue Jo £4TOTZ “ueqyne e4y SB ‘mIOs ayy JO pue Oy, 4B eeu INOL UT TITS PTNomM nok JT 4F ATezead pTNom em&#13;
*PTIOM TeInjzose,yTyore oy. UT WsTUOCTUN epBry JO [BTJUeJod eY4 JO META OTZSTTBeI B Jo puB wAooqpuey ,840e,TYOISe peTreTes, © Jo yUemMdOTeAep ayy UT Bn PTe pus seafoTdue [evinj,oeyTYQOLTe PpeTreTes fo uoTyTsod 944 pueyszepun sn d[ey [[TA sn @eAT# nok UOTYSUIOJUT eUL “VAIN @4} 0} Teaeos}eyM UOTZOeUMOD OU Sey pues eINzOaTYOTe UT AYTTTQByunoooe pue LoOBIOOMED&#13;
04 pe44TUMOD SZIeYy{O puw 8s40e4;4OTe peTazelTes jo dnoxr# yuepuedepuyt ue st WYN °TM wopuoT $q4e071S PI@TIITUM CHT ‘QUeMeAOCW erN{OeZTUOITY AO 0} UINZeT pue WIOJ sTyy eye TdwMoo esBeT{&#13;
uofun qorqa&#13;
srequeu uofun epery&#13;
0G zeao| 0G/o¢g | og tepun | we; | eTem&#13;
[eleues Y °YyoIy&#13;
eTeu (2&#13;
é(qorua eyeoTpuyT) suotTssezoad pez,eTer Mors erey} ere sreuzred Aue mAoy&#13;
Byuepnys yno-xreek (Pp&#13;
saqyeToosse (e&#13;
juawebeuew cy)&#13;
</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="39">
            <name>Creator</name>
            <description>An entity primarily responsible for making the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2047">
                <text>NAM</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="48">
            <name>Source</name>
            <description>A related resource from which the described resource is derived</description>
            <elementTextContainer>
              <elementText elementTextId="2048">
                <text>John Allan</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="40">
            <name>Date</name>
            <description>A point or period of time associated with an event in the lifecycle of the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2049">
                <text>Undated</text>
              </elementText>
            </elementTextContainer>
          </element>
        </elementContainer>
      </elementSet>
    </elementSetContainer>
  </item>
  <item itemId="370" public="1" featured="0">
    <fileContainer>
      <file fileId="447">
        <src>https://nam.maydayrooms.org/files/original/a651ff7dcdfd9b6f6aa58239c7ce9267.pdf</src>
        <authentication>a211588b0dfff8d3432b797c2332716e</authentication>
      </file>
    </fileContainer>
    <collection collectionId="7">
      <elementSetContainer>
        <elementSet elementSetId="1">
          <name>Dublin Core</name>
          <description>The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/.</description>
          <elementContainer>
            <element elementId="50">
              <name>Title</name>
              <description>A name given to the resource</description>
              <elementTextContainer>
                <elementText elementTextId="13">
                  <text>Trade Unions and Architecture</text>
                </elementText>
              </elementTextContainer>
            </element>
            <element elementId="41">
              <name>Description</name>
              <description>An account of the resource</description>
              <elementTextContainer>
                <elementText elementTextId="14">
                  <text>Themes included action on asbestos and Health &amp;amp; Safety, and involvement with Direct Labour Organisations and Building Unions. Following comparative research of possible options, NAM encouraged unionisation of building design staffs within the private sector, negotiating the establishment of a dedicated section within TASS. Though recruitment was modest the campaign identified many of the issues around terms of employment and industrial relations that underpin the processes of architectural production.</text>
                </elementText>
              </elementTextContainer>
            </element>
          </elementContainer>
        </elementSet>
      </elementSetContainer>
    </collection>
    <elementSetContainer>
      <elementSet elementSetId="1">
        <name>Dublin Core</name>
        <description>The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/.</description>
        <elementContainer>
          <element elementId="50">
            <name>Title</name>
            <description>A name given to the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2050">
                <text>Survey Draft Documents</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="49">
            <name>Subject</name>
            <description>The topic of the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2051">
                <text>Package of draft documents for workplace survey</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="39">
            <name>Creator</name>
            <description>An entity primarily responsible for making the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2052">
                <text>NAM </text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="48">
            <name>Source</name>
            <description>A related resource from which the described resource is derived</description>
            <elementTextContainer>
              <elementText elementTextId="2053">
                <text>John Allan</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="40">
            <name>Date</name>
            <description>A point or period of time associated with an event in the lifecycle of the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2054">
                <text>Jan 1979</text>
              </elementText>
            </elementTextContainer>
          </element>
        </elementContainer>
      </elementSet>
    </elementSetContainer>
  </item>
  <item itemId="371" public="1" featured="0">
    <fileContainer>
      <file fileId="387">
        <src>https://nam.maydayrooms.org/files/original/5d0860c12f184a48215ca43bc7eebb37.pdf</src>
        <authentication>d40d3d3f88de3ab9f8b5923eb24cb52c</authentication>
      </file>
    </fileContainer>
    <collection collectionId="7">
      <elementSetContainer>
        <elementSet elementSetId="1">
          <name>Dublin Core</name>
          <description>The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/.</description>
          <elementContainer>
            <element elementId="50">
              <name>Title</name>
              <description>A name given to the resource</description>
              <elementTextContainer>
                <elementText elementTextId="13">
                  <text>Trade Unions and Architecture</text>
                </elementText>
              </elementTextContainer>
            </element>
            <element elementId="41">
              <name>Description</name>
              <description>An account of the resource</description>
              <elementTextContainer>
                <elementText elementTextId="14">
                  <text>Themes included action on asbestos and Health &amp;amp; Safety, and involvement with Direct Labour Organisations and Building Unions. Following comparative research of possible options, NAM encouraged unionisation of building design staffs within the private sector, negotiating the establishment of a dedicated section within TASS. Though recruitment was modest the campaign identified many of the issues around terms of employment and industrial relations that underpin the processes of architectural production.</text>
                </elementText>
              </elementTextContainer>
            </element>
          </elementContainer>
        </elementSet>
      </elementSetContainer>
    </collection>
    <elementSetContainer>
      <elementSet elementSetId="1">
        <name>Dublin Core</name>
        <description>The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/.</description>
        <elementContainer>
          <element elementId="50">
            <name>Title</name>
            <description>A name given to the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2055">
                <text>GMWU Letter</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="49">
            <name>Subject</name>
            <description>The topic of the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2056">
                <text>Letter from GMWU to NAM re architects' relationship to users + cutting</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="41">
            <name>Description</name>
            <description>An account of the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2057">
                <text> General and Municipal&#13;
Workers’ Uimon Incorporating MATSA&#13;
Your Res&#13;
New Architecture Movement, 9 Poland Street,&#13;
London W1V 3DG&#13;
Dear Sirs,&#13;
Our Ret&#13;
RES /DG/SML&#13;
Yours faithfully, f\&#13;
' /gs | OC2 |LVSa&#13;
if&#13;
i’ DAVID BASNETT&#13;
/ | General Secretary&#13;
F.A Baker CBE WJ.C.Biggin F.Cooper F.W Cottam C.Donnet F.Ear! J.Edmonds E.P Newall MW Reed JP R.Smith Patricia Turner D Wart irton&#13;
National Industria! Officers.&#13;
8th November, 1978&#13;
I am writing to enquire whether you give any support to&#13;
the idea that the people who consume the products of your profession should be involved in their specification and planning. We have&#13;
had a great deal of evidence from our members in the past to show that health, safety and welfare have not been effectively included&#13;
‘in the design specifications for new buildings, and that the views of eventual users are frequently excluded from the consultative stages. As part of our effort to eliminate hazards at source we&#13;
are ivising our members that they should be involved at the earlies ot of planning alterations to existing premises or of construct-&#13;
.ew ones, You may know that the new Safety Representative and .ety Committee Regulations 1978 oblige employers to provide safety&#13;
presentatives with information about "the plans" and their proposed changes" insofar as they affect health and safety.&#13;
I am sure that many architects would welcome closer liaison between themselves and users of their designs, and the article regarding an order office at BOC Crawley in yesterdays Guardian&#13;
(7th November - Women's Page, Peter Gorb) illustrates the general point we are making,&#13;
We would like your comments on this, and in particular any support that you can give to the practice of closer liaison&#13;
between user and: architect. We realise that the extent and nature of liaison will have to be agreed between the architect's client and eventual users, but if we knew that architects would welcome this idea it would assist in its general adoption.&#13;
I enclose a copy of the Guardian article for your information.&#13;
</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="39">
            <name>Creator</name>
            <description>An entity primarily responsible for making the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2058">
                <text>D Basnett</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="48">
            <name>Source</name>
            <description>A related resource from which the described resource is derived</description>
            <elementTextContainer>
              <elementText elementTextId="2059">
                <text>John Allan</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="40">
            <name>Date</name>
            <description>A point or period of time associated with an event in the lifecycle of the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2060">
                <text>8.11.78</text>
              </elementText>
            </elementTextContainer>
          </element>
        </elementContainer>
      </elementSet>
    </elementSetContainer>
  </item>
  <item itemId="372" public="1" featured="0">
    <fileContainer>
      <file fileId="389">
        <src>https://nam.maydayrooms.org/files/original/da414e60427de80023f203c87961f9af.pdf</src>
        <authentication>c6d7df2d9500ca68216f05b9c8d56677</authentication>
      </file>
    </fileContainer>
    <collection collectionId="7">
      <elementSetContainer>
        <elementSet elementSetId="1">
          <name>Dublin Core</name>
          <description>The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/.</description>
          <elementContainer>
            <element elementId="50">
              <name>Title</name>
              <description>A name given to the resource</description>
              <elementTextContainer>
                <elementText elementTextId="13">
                  <text>Trade Unions and Architecture</text>
                </elementText>
              </elementTextContainer>
            </element>
            <element elementId="41">
              <name>Description</name>
              <description>An account of the resource</description>
              <elementTextContainer>
                <elementText elementTextId="14">
                  <text>Themes included action on asbestos and Health &amp;amp; Safety, and involvement with Direct Labour Organisations and Building Unions. Following comparative research of possible options, NAM encouraged unionisation of building design staffs within the private sector, negotiating the establishment of a dedicated section within TASS. Though recruitment was modest the campaign identified many of the issues around terms of employment and industrial relations that underpin the processes of architectural production.</text>
                </elementText>
              </elementTextContainer>
            </element>
          </elementContainer>
        </elementSet>
      </elementSetContainer>
    </collection>
    <elementSetContainer>
      <elementSet elementSetId="1">
        <name>Dublin Core</name>
        <description>The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/.</description>
        <elementContainer>
          <element elementId="50">
            <name>Title</name>
            <description>A name given to the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2061">
                <text>Newspaper of TASS BDS</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="49">
            <name>Subject</name>
            <description>The topic of the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2062">
                <text>4 sides A3 newspaper "Who pays it…Who gets it ?", et.al.</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="41">
            <name>Description</name>
            <description>An account of the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2063">
                <text> Who&#13;
The end of professionalism as we know it,or the first step back to reality? Variously described as a ‘bombshell’ and a ‘foregone conclusion’, the Monopolies Commission Report on Architects’ Services promises to be a major topic of debate among the architectural profession during 1978. Because it opens the entire Pandor's Box of fees, profits, salaries and quality of service and the relationship—if any—among them, it is as worthy of attention by architectural staff as by the partners who were the prime object of the enquiry. In fact salaried staff haveacriticalroletoplayinshapinganew system of architects’ fees.&#13;
The Story So Far&#13;
In case there are any readers still unfamiliar with the main gist of the Monopolies Commission Report, ict us begin with a brief outline of the events leading up to the present situation. The Monopolies Commission Report, ‘Architects’ Services—A Report on the Supply of Architects” Services with Reference to Scale Fees’, was&#13;
published by HMSO on 9 November 1977 after four years of investigation carried out at the instigation of the Department of Trade and Industry, was not the first time the&#13;
|Government examined theprefessiononthis&#13;
if .beiasdfo Asjongdebenpcosage the Natinna! Board&#13;
pays&#13;
Who&#13;
gets it?&#13;
employer-dominated RIBA is already trying to Propagate the fallacy that dropping the man- datory scale will lead, through “fee cutting’, to reduced salaries for staff and increasing likelihood of redundancies in times of depression. This last ditch attempt to save the present high profit, low-salary system relies onpresenting the picture of a homogenous profession united against changes that ‘will entail a lowering of standards’. Anyone stil holding a lingering belief in these argurnents should ponder how successful the existing fee scale system has been in distributing profits, equalising salaries with other professions, preventing redundancies and main- taining “Standards’—in the light of, respectively, the above quoted figues the unprecedented numbers of architectural workers currently unemployed and the almost ambiguous public disenchantement with our profession.&#13;
Alas, the mandatory minimum fees scale may be capable of procuring healthy profits for partners in private practice, but it is less successful at performing these more important functions.&#13;
Rather than rushing to the defence of their employers’ fee scale, salaried staff would do better to organise in TASS in order to exercise effectively their combined strength and secure equitable salaries and conditions. At the same time organisation will allow them to begin, together with other organised workers in the construction industry, to bring to bear on the&#13;
Prisca rand laconseaensuitvecorir’ nded that tm mandatory fee scales should be dropped. Although several amendments to the scales followed that report, the RIBA contested its principal proposal and, bya mixture of obstinacy&#13;
What else should salaried staff do?&#13;
1, The Commission has opened the door to a major rethink in the way archictects are paid. Salaried staff can press fora new fee system based on the cost of architectural seryices rather than the capital costs of construction.&#13;
2. Implementation of the Monopolies Com- mission's findings will entail major surgery to the Codes of Professional Conduct. Salaried architects can play an integral part in reforming the Codes by exerting their influence through TASS, their ARCUK representatives and the technical press.&#13;
and stealth, succeeded in retaining the mandatory status of the fee scale. By assigning the present investigatiootnhe Monopolies Commissiont,he Government in effect made the mandatory element of architects’ fees the prime target. The Commission's conclusion that the monopoly operates to the detriment of the public interest has made the abolition of the RIBA—sponsored ‘price ring’ (the scale of Fees) a virtual certaintly Few peoplestill expect that the RIBA Conditions of Engagement and the RIBA and ARCUK Codes of Professional Conduct will last out the year in their present forms&#13;
The main feature characterising the system of architects’ fees in the UK is that here fees are&#13;
union organisation&#13;
Nor surprisingltyh,e Monopolies Commission&#13;
Issue 1 May 1978&#13;
The Commission's Report has now passed to based almost exclusively on a percentage of&#13;
the Director of Fair Trading who must report to contruction costs. This distinguishes it from the&#13;
the Minister by May on his progress in dis- systems of virtually every other country covered&#13;
cussionswiththeRIBAandARCUK astohow bytheEnquiry,(seeReport,Appendisx6,p156),&#13;
their rules will be changed to give effect to the in which some serious attempt is made to relate&#13;
Commission'srecommendatsions,aswellason feestothedegreeofcomplexityofthebuilding siblity occupationswithoutmandatoryfee forsttaodfisfcussopenlyamongthemselvestheir&#13;
hisprogressinpreparingforanindependent project.Thedifferiesnsicmpelebutimportant.In&#13;
agency to determine a new system of voluntary the UK fees are based on the clients’ building&#13;
fee scales. If the Minister considers that the RIBA costs, whereas elsewhere fees relate more closely&#13;
and the RIBA dominated ARCUK are dragging to the actual cost of providing the architecutral&#13;
their feet in these matters, he will make an Order service. Architectural design being labour rather&#13;
ofParliamentrequiringthenecessarychanges, thancapitalintensive,coarsectompsrisedalmost in1973,thelastyearforwhichfigueswere overheadsandprofitsaswell. which if unchallenged in the Commons acquires entirely of staff salaries and overheads.&#13;
theforceoflawafter40days.Inshort,the TheRIBAfeescaledivtoherdetcermeinastionof&#13;
available to the Commission. Hands up all 4. Lastly, the Monopolies Commission requires salariedstaffcarningevenhalfthatamountfor thesettingupofaspecialagencytodevise&#13;
Government issaying to the RIBA ‘Jumpnow, or we'll push you"&#13;
Eight Tenths of the Iceberg&#13;
practice income from the cost of providing the service, thereby reducing the leverage staff may exert in influencing their own salary levels. We are all familiar with the large practices doing large projects who minimize design input and max-&#13;
those years&#13;
Of even greater significans the Commission's&#13;
proposals for a new fee system, but deliberately left its composition and terms of reference vague so that they could be the subject of recommen- dations by all interested parties. If architectural workers will take the initiative and debate the&#13;
Readers are probably aware that since the imise partners’ profits, since they can't be Commission's investigation was into fees—as ‘undercut.’ Without a minimum fee scale, they distinctfromsalaries—itsattenwatsfiocousnsed mighthavetoprovideaqualityofserviceto primarily on the activities of principals in private&#13;
survey further showed that principals’ profits&#13;
increase dramatically with the size of practice&#13;
Figures for 1973 show average profit per principal&#13;
rising from £6,469 in partnerships with 1-5 direction the agency should go, they have only to technical staff (including partners) to £61,394 in present their case to the Directorof Fair Trading. partnershipswithover50!(Andprofitsofsome&#13;
practice, hardly 10 per cent of the architectural&#13;
profession and their clients. These are the parties,&#13;
who respectively charge and pay mandatory to high profits but ithas had littlebeneficial effect minimum fees. These parties however, represent on the salaries of the architectural staff who only the tips of two very large icebergs, namely actually get the job done and earn those profits the building design staffs, 90 per cent of the Salaries, not surprisingly, bear little relation to a profession who provide the bulk of architects’ practice's fee income under the present system services;andthecommunity,whoasusersof Whenfee’sgoup,it’sthepartners’profitsthat buildings form the groups whom the clients rise, not salaries.&#13;
‘Tepresent’. Although neither receive much Salaried staff must face the fact that their coverage in the Commission’s Report it is standard of living depends on two factors far less&#13;
ceriainly none too soon to speculate how both will be affected by its recommendations though in the case of this article we concentrate on the former.&#13;
UK on its own&#13;
esoteric than the mandatory status of their bosses” fee scale:&#13;
1. the demand for architectural staff, which is of course a function of ‘work load’ in the industry, rather than fee income, and&#13;
2 the degree to which architectural staff exercise their collective industrial strength through trade&#13;
fee scale for the partners than in a mandatory minimum salary scale for the 90 per cent of the profession who are salaried.&#13;
Farago of fallacies&#13;
Salaried staffs must grasp these facts fast, as the&#13;
Movement. ‘The Monopolies Commission Report—A Straight Forward Guide’, pull-out feature inSLATE 5, also the full NAM-report ‘Do not pass go—DO NOT Collect (4° Both from 9, Poland Street, London, W.1.&#13;
John Allan&#13;
justify such lucrative fees... and pay the salaries to get it!&#13;
of the professions most lucrative big firms weren't Reveille&#13;
even included in the survey!) The point to&#13;
remember is that though big practices are less&#13;
numerous than small ones, they nevertheless In condemning the existing fee system the employ most building design staff. This means Monopolies Commission has unwittingly helped quite bluntly that most architectural workers are Point the way for salaried staff in architectural busy carning the largest profits for their offices to better conditions. For years the system employers little of which is ever passed on to has been operated by principals for principals. themselves. Willstaffallowanewsystemtooperatelikewise?&#13;
Many staff are now beginning to remedy this&#13;
situation by organising in TASS. They are less Readers wishing to pursue this subject further are likely to be interested in a mandatory minimum referred to matcrial published by the New Architecture&#13;
The minimum fee scale may help the partners&#13;
In this issue we start o special insert on the major issues affecting building design staff. We hope readers will keep these inserts and build them up into a library and thus in time give members demands an authority which they would otherwise not have inthis issue, welookat the Monopolies Commission Report, Pensions, and the Government's recent Green Poperon Housing. Ideas and articles for future features are most welcome&#13;
discovered that the revenue yielded by the present&#13;
fee system has not been equitably distributed to&#13;
provide architectural staff with salaries com- Percentages of construction costs. But how much parable with those in other occupations at similar do staff know about salaries, overheads, and levels of qualification, experience and respon- partners profits? Often the easiest way to begin is&#13;
scales, ownsalaries.(Thosewhoneverbeforehaveare The average profit per prinicpal in all usually quite surprised at what they learn). The partnerships (including the many small ones next step is to organise in TASS, achieve union’ without staff where fee income relates more recognition and press for “open books’ in orderto closely to costs) was estimated at nearly £13,000 give staff a clear understanding of the firm's&#13;
overnment the kind of pressure w!&#13;
better&#13;
3. Everyone knows the present fee system of&#13;
&#13;
 The Government Housing Green Paper reafirms to people who have ben defined in some way ms&#13;
propesedistometexceptionalneds&#13;
ment, housing and political party and housing&#13;
case following increasing general afluence, the| for the workers. The aiim was to show that good&#13;
cheapertobuildandcanbebuilttohigher Crossland’sviews,theLabourGovernmentnow|,yeresetatalevelwhichevenartisans thatrents similartothosedesignedforsocialcontrol.19th&#13;
intopublicsectorhousingstandards.Thiswil foptionof th&#13;
speculative housing market. These are below those whichhavebeeninforceinthepublicsectorsince&#13;
maxima. Any reduction’ willcertainly mean a loweringofquality.Intheprivatesectoritmaybe thatacouplecanbuya3or4personunitandthata 4personfamilycanbuya5or6personunit.Thisis not, however, the case in the public sector, wl 4personfamilywouldordinarilybeallocateda4&#13;
makagreatrdeal.sIf,youareconcernedabout&#13;
oo about the|compensateforthelowerspacestandard&#13;
Property, and perhapsadifferent area.&#13;
ust be repaired adequately in order to achieve&#13;
Neaparticulardutytoprovide forthasewhocouldnot goalofsociety.Individualsgouptheladderone Tung atatime.&#13;
werebased,arguedstronglyforhouseswith gardens rather than flats. This predisposal towards runing through bour&#13;
| From the Peabody tenements of the 1870's to Herbert Morrison's LCC flats of the 1930's, nd then fo the tower blocks of Birmingham&#13;
Slasgow in the 1960's, one can se only a slippery line of descent from one optimistic | ‘solution’ of the housing problem to the next; each one increasingly inhumane and inflexi- ble, and each more rapidly becoming ob- solete. The Peabodies were slums in 70 years;&#13;
The Morrison flats in les than 40. With | sing speed of improvement in the standard of livingou,r bravetower blocks are | likely to haye an acceptable life of bately 20. years—only athirdofthewaythroughthe | repayment of the instalments on the loans by&#13;
which they are built.&#13;
The Government Green Paper ‘Housing&#13;
ative Document’ afforded an oppor- tunityfora radicalreappraisalofwhatwe buildandhowwefinanceit.The GrenPaper isadisappointment. Itmakes very few and in some cases damaging and discriminatory proposals for solving the housing problem.&#13;
We as architects, planners, engineers and surveyors cannot aford to sit on the fance. tion that itis adapt someand ies—of theplaces we live in—in the light of radicaly changed conditionsoftodayand tomorow.Wilthe public good prevail, orwill profit motives&#13;
{both private and public developer al |override public interests and amenities by squeezing the last ounce of revenue out of the development at the expense of quality and a&#13;
civilised environment?&#13;
Labour government Therelationshipsbetweenhousingandgovern&#13;
of the cotage style. The cheapest plan fo&#13;
rectanglelaidouttothehighestdensityallowedby abourGovernmentinthe1960'sandinthe1977 sanitationandadequateworkerhousingwere Although&#13;
the planning authority together with that commen- Green Paper have attempted a more extensive | compatible with a fair return on capital. But the the gate is long discarded, many suratewithmarketdemands.Butalthoughterraces integrationofthetwocultures. Infollowing||isingcostofcentralarealandmeant Presentdayhousingschemesdisplayfeatures&#13;
formandpoliticalpartymayberegardednot | merely as a result of political party policies, but as part of an overall pattern of how cultural&#13;
densitics, they account for only a third of owner appears to believe that clas differences and, thus, | {ford could barely uses. Detached and semi-detached opposing cultural ideas have lafgely been sub~&#13;
Tegulations, but in the social knowledge of designers,&#13;
relationiships are established and reproduced,&#13;
in’perpetuating existing social arraisbements togetheraccountfor67percentofowneroccupied sumed into one general dominant culture, | |‘Thee«combined efforts of commerce&#13;
societyproducesideaswhichfurtherthedominant houses, Thereisthusacorresponbedtewenencethe&#13;
Followingthislineofargument,emphasis philanthropyandcharityhardlymadeanyimpres- oneortheotherformoftenurecan on|sionontheproblem.Loacndacenltralgovernment emphasis on one or the otheronlybeseen as_|,became involved inhousing through asuccession&#13;
dassandarerepresentedastheonlyrationaland universally valid ones. These ideas, attitudes and&#13;
ideas of individuality and the desirabi&#13;
sed both in terms of cost and the&#13;
culture. The|oftumclearancelegislation.Eventually,theywere GovernmentGreenPapertacitlyacceptsthatview|forcedtofinancehousingandbuilding,théfirst aCDPpublication‘WhateverhappenedtoCouncil&#13;
formadominantculture&#13;
Themostimportantoftheseideas,accordingto Jacksonnotesthatinthe19thcentury‘most&#13;
whichsaysthatsocietyisnotdividedintoopposing)councilestatebeing193threeroomeddwellings classes, but it is a continuation of individuals | opened in Liverpool in 1875. Seven years later the rankedinorderofmerit.Thewinnersgetdetached|LCCobtainedpermissiontobuild,inLimehouse vilas.Thelosersgetcouncilhouses.&#13;
Raymond Williams, is a belief in individualism. knew exactly what their potential&#13;
Thecorrespon igideainthefioefhloudsingisthe |customersrequired.Assiduously,oftenclumsily, 197GovermentGreenPaper‘Housing,a conceptofprivateownership.Thepotential theystrovetoevokeatleastasuggestionofthat&#13;
thefirstcouncilestateinLondon.lance 2&#13;
nypeoplethekindofhometheyward This view, which promotes owner occupation tothe&#13;
In&#13;
PrOCES,&#13;
onlyofhowtheexpandingworkerpopulationwas|AddisonActlaunchedthecountry’sfirstfulscale architectatthedrawingboardtotheapprenticoen&#13;
housingprojectstoday,thenjoinTASandwith yourcoleagues,workforabeterfuture.&#13;
oppositionbetweentherighofttsheindividualand&#13;
the limiting of private ownership is resolved by a&#13;
further concept—that of the idea of permanent&#13;
scarcity associated with success through individual&#13;
meritachievedincompetitionwith otherin&#13;
dividuals. Society may then be considered as a&#13;
continuumwiththesuccessfulatonepoleandthe this‘safeguard’doesnotexist,Anditisherethat housedbutofhowtheyandthemiddleclas}housingprogramme.By1915lackofhousesfor&#13;
summarises&#13;
conyentionalwixdam.Atthesametimecouncilhousing inadequateattheother.Inbetweenisaseriesof government policiescanbescenoperatingto isrelegatedtohomesforsociety'sdeprived. stratifications,ofhurdlestobeovercomeenroute. controlthebuiltform.TheTudorWaltersReport,&#13;
perceivedtheproblem. Theappearanceofcholera|renthadbecomeacute.Houserentsrosesteeply&#13;
whichscourgedthepopulationwithoutregardfor|andtheresultingdemonstrationsbyaggrieved Althoughthegovernmentproposesthepartial ‘Decayinginercityareasmustberevived.Thiswil clasorlocalitybroughttoattentiontheextentof|tenantsinGlasgow‘camenearenoughtothe restorationofpastcutsinexpenditurethiswilstilrequirehighinvestmentwhichmustbemadenow.’ *replacementoftherofcoveringandrepairing theproblemwhichalreadyexistedandwhichgrew|appearanceofrevolutionathomewhiletheamounttoonly£830milionofthe£1.30milion ThisistheesenceoftheresponofsteheTASS- andstrengtheningoftherofstruc asthepopulationexpanded.Itwasaproblemof|countrywasatwarinEuropetofrightenthe BDSLondonBranchtotheGovernment's ©stabilisingtheexternalfabric; thedistributionofdwellingsandadeclineinthe|Government’intopassingtheRentandMortgage Sinceaurgeproportionofarchitecturalstaf HousingGrenPapTeherGr.eenPapisearwide efficiencyofpublicservices,especiallywater|RestrictionsAct1915.Rentswerenowfixedat workonhoustihenovger,allefectwilcontinueto rangingdocumentreviewingalaspeofchotusing&#13;
supplyandwastedisposal suchalevelthatprivatespeculatorsnolongermeanalossofjobs.Ithepublicsector,somelocal policybothinthepublicandprivatesectorandhas&#13;
honities.newtownsandhousingaxsociations Thesuccessfulendoftheladderisheldtobethe onwhichthedesignsforthefirstcouncilhouses&#13;
Furthermore, relations between individuals are indirect, mediatedbymoney,sothatthewhole starts social organisation can readily be thought ofas a&#13;
governmenthousingpoliciesexceptforabreakin&#13;
‘aggregaitecadnbesenthatforthefirsttimeaLabour marketpluor.Thehousingmarketcanbeandis jeramenthaspresidedoverasituationwheremore overlaidonthiscontinuum.Thetenuranedformof&#13;
Between1919and1927forexampleaperiodof WriterslikeStedmanJoneshavedescribedhow|founditeconomictobuildforrenttoworkers.The authorityarchitectsdepartments(mostrecently Onlythencanitbeimproved.Ifthisisnot&#13;
deepeninglabourinfluence85percentofcouncil petvatethanpublicsectorhousesarebeingrenovatedor housingmustreinforcetheideasofthedominant houseswereofthecottagetype.Between1930and Thediferencefsstilsmall—210,000private culture.Justbecauseoftheveryimmediacyofthe 1939underacoalitiongovernment,Jesthan7per&#13;
sanitary,socialandmoralquestionswereinex-|governmentconcludedthatitcouldnolongerlook HillingdonandYork)arealreadysubjectto TheBranchbelievesthatthePaperwastedan possiblenowwhatwilafurtherreductionin&#13;
century,boweverbriefly,matykestlb_ninatetheirsue.&#13;
betwenthenatureofthegovernmentinoficeand Rangedagainstthis,speculativehousing,bothin&#13;
and high sensity flats for council tenants are the hal marks of their public sector housing policies, the&#13;
a policy of high density city centre for al subsequent housing legislation. There| flated tenements linked to slum clearance. This&#13;
©wasalsoalink,whetherdirectorindirect |between the built form of council h&#13;
Anon-traditionalformofhighdensity associated on the one hand with slum clearance and&#13;
cottage idiom, has been linked to g&#13;
operationandinbuiltform,expressesvery&#13;
trolledmoreandmorepreciselythelayoutand|establishedbythedesignersofthe19thcentury ; Aggregationofthehousinguni modeldwellings.&#13;
.&#13;
“basicstandard”ratherthanmakea‘fulimprove- ment’asdonenow,toasmallernumber.&#13;
buit asthe visiblecontextcorrespond toand reinforce these overall ideas which we take for granted.&#13;
whilstlimitingthedebatewithinunnecessarily vertedfor£10,f0ive0or0sixyearsago(pritotrhe 1974 Housing Act) arenow having major repairs They also critisiced it for emphasising owner carried out at costs up to£5,000. Not onlyis this a deper occupationastheprimaryformoftenurewhilst veryhighmaintenancecostbutitdoesn’ttakeinto&#13;
The form of the speculative house iscontrolled Itisreproduced and reinforces&#13;
Although the 1890 Housing of the Working ClassesActgavethelocalauthoritiesthepowerto Thehistoryofhousinginthe19thcentury,asinthe| acquirelandandtobuild,houseprovisiondidnot 20th,isessentiallyanurbanone,Itisarecordnot|becomeastatutorydutyuntil1919whenthe&#13;
Private sector by future extension thelikelyefectsoftheGovernments quick,comer-cuttingquantitativeapproachto impossibleinthepublicsectorwhereth&#13;
centofcouncilhousesbuiltwereofthecottage&#13;
happenedcanonlybeanswredbysituatingthewhole Councilhousingdoesnotreinforcethedomi- designguidesandstatementshavefavoureda TheGovernmentintervenedin1844byin-|government'shousingpolicyprogramme&#13;
fnthefactthatithasoccurredatal&#13;
This break with pre-1964 Labour Government&#13;
houningpolicesisintriguing.Theobviousquestionwhat&#13;
welasofilhealth i BolshevismtoprodtheCabinetintoacceptinghis&#13;
thanlosofjobs.Localauthoritystafwilbecome restrictingcouncilhousingtopeoplewhohave&#13;
nantculturebutisinopposititonitinanumberof traditionalformwithalimitofthreestoreys, ways.Itisinfactaformofhousingwhich Emphasisonrehabilitationcompletesthepicture represents the ideas of an oppositional culture Conservative administrators seck to reinforce&#13;
troducingtheLondonMetropolitanBuildingAct| By1919also,thetwobuscformsofworkers whichfor the first time imposed restrictions onthe | housing had already been established. The Tudor way buildings could be related to each other, | Walters Committee of 1918 recommended subur- minimumstreetwidths,lightingandventilationof|banlowdensitycottages.Until1964thiswas habitable rooms. This Act was followed by the | Labour's approach to council housing. Conser- PublicHealthAct1845whichlaidthefoundation| ¥ativesfavoured&#13;
increasinglydemoralisedastheyscetheirofices&#13;
experimentation&#13;
will be frustrated by lack of funds, so architects and&#13;
beendefinedinsomewaysasdisadvantageous, ©thedisplacementofestablished&#13;
Councilhousingisremovedfromthemarket theideasofthedominantculture.Slumclearance&#13;
©thelosofrentswhilework isc:&#13;
The Union is opposed to any lowering of&#13;
standards. These reductions are in effect already “Therearestil9.2milionpeopleinBritain takingplace.TheHousingCorporationhasissued livinginhousingunfitforhumanhabitation, guidance notes to housing associations&#13;
reductions in specifications for rehabilitation in&#13;
order that more conversions can be achievedusing&#13;
the same money. A number of housing associations&#13;
fear that, by freezing the Housing Association&#13;
grants and keeping yardstick increases to a rate&#13;
lower than that needed to keep pace with inflation&#13;
Oncebuiltitdoesnotbecome acommodity,buti solely for use. Secondly with its pooled bistoric costsete.council housingexpressestheideasof collectively rather than individualism. Houses are not achieved by success on the ladder of society&#13;
squalid. The new high density developmentofcouncilflatscompetewithowner precisclytheideasofindividualismandsuccess occupationneitherinquantitynorinbuiltform.&#13;
from acontinuingfallin.workloadandhence&#13;
through individual merit, the success being measured by value. In council housing, use predominates,Intheprivatemarket,valueisthe criterion&#13;
The Conservative problem, however, is how to avoidsocialunrestamongstthosewhocannot compete in the housing market. For Labour the problem ismore dificult. Ifthey perform their&#13;
The early Acts, included provision for demoli- | | An examination of contemporary 19th century tion,stretclearance,accordingtoStedmanJones,| literatureonthesubjectrevealsthatanapparently wereinbredwithalmostmagicalefficiency.A|functionalsolutiontoaphysicalproblem reading of housing history shows how successive was in&#13;
Insocietywherevalueisthecriterioncouncil functionasagovernmenttheyadvathenidceaesof&#13;
fact rooted in ideas about social control. Model Conservative governments until the 1960's also | dwellings were designed to enable easy and turnedtoslumclearanceinaneforttocontrolthe| ¢fectivesupervision —‘regulationwithoutdirect nature and appearance ofworker livingconditions. | control’ as itwas caled. The frontages therefore Butdemolitionexacerbatedtheproblem.Thepoor facedontoasquareratherthanastret.Therewere did not disperse a limited number of access stairs and in many cases formers turned towards the problem of who | the one entrance and exit from the square was&#13;
lacking baths, hot water, inside lavatories, or innedofmajorrepairs.The(Housing)Green Paper isnot worth the paper itiswriten on until and unles the cuts in housing are&#13;
housing does not conform and may thus considered a threat to the dominant culture. Conservative governments are likely to suppress council housing and Labour governments to further it&#13;
the dominant culture, Insofar as they support the oppositional culture and its ideas they are in&#13;
integrate the two cultures by producing council jhousing which adheres in form, but not in tenure, iotheideasofthedominantculture&#13;
and this trend is likely to continue. Many architects&#13;
Form,however,issecondarytotenure.Inwhic!&#13;
takinga‘lowestcommondenominator’approach authoritiestheintroductionofgreaterfl&#13;
Upa blind alle&#13;
tricablylinkedtothequestionofhousingthepor.|toprivateenterprisetoprovidethegoodquality Themiddleclasbelievedthatthebringing|homesprotomtheiretusrninegsodldiers.The1919 togetherofthepoorinlargenumbers,inareaslike|ActwasalsoinfluencedbytheHunterand theLondon Rookerwhieresth,ere waslitleorno | Salisbury Commission, aided according to Enid access by the middle clas, created a danger of| Gauldic, by Lloyd George who used the dangerosf&#13;
and—bureaucratic&#13;
spendinggiveus?InonewelrespectedLondon . The opportunitytoreappraisethecountry’shousing housingassociationpropertiesboughtandcon&#13;
igners wil by pushed more and more into followedaseriesofActs(descnbedindetailby|policyculminatedinthetowerandslabblocksof applyingstandardplansandstandardformulae.&#13;
Theyreomldohousvinge whichis,intheirterms, EnidGauldiein‘CruelHabitations’whichcon-|the19$0sand1960s.The geneictypewas Theprivatesectormayalsobeexpectedtosuffer possiblebyimproving’thesehousteosanadequate&#13;
working in private practices, wil hesitate about moralrulesregardingbothfamilylifeandhome- workingforthepackagedeaker—whomtheyseeas falingbackontheGreenPaper&#13;
therebylabellingthepublicsectorassecondclas&#13;
Promised in the Green Paper would also result ina reduction in the quality of housing provided both innew construction and inrehabilitation. Itaims&#13;
Another worrying resultofcutbacks expenditure isthedisastrousefecttheyha unemployment, but they also result in lowering of&#13;
it&#13;
The built form&#13;
also. The ofhousing&#13;
‘speculative’house seemstobe&#13;
which appearsrelated&#13;
as an&#13;
archetype througtheocountry isadevelopment&#13;
should provide housing for the poor how itshould | controlled by a gate locked at 11,00pm. Strict be financed and managed, and what standards of&#13;
accommodation should be provided. Private { working completed a picture of the Victorian philantrhopists elected to build model dwellings } middleclasses’ determitonianctulicatoenthe ideas&#13;
&#13;
 | There was theflat rate old age persion scheme, |whicheverybodyere butwhichno-one&#13;
relied upon unless they 0.&#13;
| ‘Therewasthegraduatedpensionscheme,which&#13;
no-oOneseetmohsave underosrrteloiedoudpon | with any confidence. ;&#13;
Now we have the new State Pension Scheme, introduced by the 1975 Social Security Pensons Act, which is not impossble to understand, and doesseemtoprovideareasopensiaonbfolremost people, The new State scheme, which becomes effective on 6 April 1978 scts out to guarantee that al employed people will get a pension on&#13;
retirement.&#13;
For those people whose working life conforms to&#13;
a certain idea of ‘normality’ this will be a pension \on retirement which issufficient tomaintain astyle |oflifecomparable totheonethey‘enjoyed’ whilst&#13;
s ers Theamountofcontributionandne ATTA 1 ae eeab they within ¢ertain limits, But the&#13;
Rove orfpeasion is not determined by mnominal cash carnings. It is determined by the value of carnings. On retirement, the amount of pension having been established, its value ts then main-&#13;
ined irrespective of inflation. That, at Jeast, is the&#13;
upoftwoclements Thereis nt availab &gt;all wh have almost all heir p&#13;
sbasiic pension sadjust es in its purchasing pov&#13;
you ret re or&#13;
G&#13;
compulsory state scheme. to the In doing this they will&#13;
elemen ating to the value of tain| mit. W an indivadua&#13;
entagetheiractu: earnings(uptc altuoaellodwfor&#13;
ee S a&#13;
»make some allowance f inflation. mitof earnngswhichwill contribute&#13;
the same contribution as before if the scheme is similar but the pension received from the second employment will be reduced to three quarters (it will relate to 30 and not 40 years) and the frozen pension from the first employment will yield about onetwelthratherthanthequarterwhichisneeded to bring it up to its expected level. The more an employee changes jobs the greater the rate of inflation, the less pension is received on retirement.&#13;
What is the solution of this difficulty? If one Private pension scheme were to be adopted by the majority of employees in the private building design sector, then transfer of pensions would be facilitated and they would not have to befrozen when employees changed jobs,&#13;
The Architects Benevolent Pension Fund Trust offer a scheme of this sort, but it has to date been adopted by only forty offices. In many offices the Pension scheme chosen is an extension of insurance schemes already selected by the Principals which may explain the multiplicity of pension arrangements. It seems that itisdifficult to designa Private scheme which suits both large and small offices.&#13;
Will you still pay eC&#13;
you? The ways of government me carmings related clement is also departments are strange. The only way to find the&#13;
d periodically. The scheme, which came answer to this question is to ask, with caution on 6 Apnil, fixes the upper limit at Most employers wil, by now, have decided tannum. So, if TASS-BDS does whether tocontract out or An employer who&#13;
ost building design staff should be contracts out of the state Pension scheme has to king for some means of topping up their state&#13;
proportions&#13;
and How You Benefit’. If you want tc&#13;
is that the DHSS computer doe tbl W Up just as&#13;
produce enough children Unfortunate!&#13;
not benefit from the contributions which the employer makes to an occupational scheme and it is unlikely employces will really be able to squeeze the equivalent cash from the employer as extra salary&#13;
senior citizen utopia for al&#13;
protra | educa&#13;
Cement reduced&#13;
have a&#13;
The solution to these difficulties is obviously not clear, but it may be that the majority of large offices could be persuaded to adopt one main scheme, and that employees working in small offices might choose to rely on the state pension scheme plus individual life insurance, at least during thecarly&#13;
The&#13;
Xplains at what point you cross the&#13;
nts on&#13;
part of their working lives when they are most likely to change jobs.&#13;
What&#13;
carnings&#13;
Avetleeaty tiwevl&#13;
Employees can refuse to join occupational pension schemes and buy insurance to provide any&#13;
benefits that they require in addition&#13;
Pensions! The mere mention of the subject brings # glazed kook into eyes that have not scenthirty |summers and a distracted and nervous twitch to&#13;
i&#13;
|those that have seen more than forty.&#13;
The Radio Times usedto carry an advertisement for lifeinsurance showing adapperchap oftwenty saying‘ItscleikemasprettygoodjobbutIhear |they don’t have a scheme’, As time passed |hegraduallybecaamsiextyeho erie fora&#13;
pe purse of trancuilisers : |asteror ichwusfrelyavailablethen)tearing | at his scalp und saying ‘only five years fo go to retirement. What am Igoing todo? Itwouldhave beenfunnyifithadnotbesoetragnicallytrtuoleife.&#13;
| The State Pension scheme has gradually |improved since the days whe, ifyou ork) Tos | worked until you were no longer fit, and were&#13;
|&#13;
sent to the workhouse hospital oto live on the&#13;
Rubican. It does not tel what happens if you do!&#13;
Provide an alternative pension scheme which meets the criteria laid down by the DHSS. The contrib-&#13;
a&#13;
OFJoininganoccupationalpensionscheme,orbytuionstothestateschemearethenredutcoaefdlat putting pennies under the mattress rate. The contracted out scheme must Provide a&#13;
The whole c related \ conseque!&#13;
of the new state scheme is guaranteed minimum pension which is the sameas F than cash amounts, and isthe pension which would have been Provided under&#13;
ner fluid. The actual figures, the state scheme. It will usually provide benefits that the guaranteed minimum and the contnibutions will be greater than those required by thestatescheme. Ifforsome reasonacontracted&#13;
this scheme does not provide a Those who are self-&#13;
employed or who work aborad or whc&#13;
1contributionand benefitaresetout in the DHSS leaflet NP30 ‘New Pensions&#13;
acted period of self-discovery and informal n for too long wil find their pension&#13;
I'm 64&#13;
pensions. This can be done by buying life insurance&#13;
Predict the value of your state pension you will out scheme can be seen to fail to work in an © read the leaflet with your own case in mind ndividual employees case there is Provision for the Set out what you ¢ * to carn on the basis of private scheme to make a payment direct to the Present s: scales, a ic ¢ what you will DHSS to compensate for the reduced con- getintermsofcurrentvalue.Allyoucanhopether tributions,andtheindividualis“boughtback’into&#13;
you would get a proportion of the pension wouldn't&#13;
the state scheme&#13;
some Government doesn't start The benefits provided by a Private “contracted&#13;
fiddling theindex to control money Supply through out’ pension scheme are additiofial to the basic&#13;
pensions, or that the predicted diminiti Population doesn't rebel at maintain enormous retired population which&#13;
state pension and are only substituted for the carmings related element of the state pension. So the level of your notional state Pension not only affects the ount of benefit from the private scheme through the guaranteed minimum but you&#13;
will actually be trotting along to the Post Office to collect one part of your Pension from the state whilst receiving separate Payments from the Private scheme. It seems that there will also be some arrangement as yet undefined, whereby the incre the notional related&#13;
element of your pension will be paid to your direct of the We understand that the DHSS wil notgive general by the DHSS. Anyone who has changed jobs and 1 the best wenty information about these cases but will o belongs to several different contracted out schemes ye carnings. This element of the consider each indiv dual enquiry. It is implied that will surely be receiving pennies from all con-&#13;
pen $salsosubsequentlyadjustedafterretire-youwillloseallrigtohatstsatepensionbutsurelyceivabledirections.&#13;
Employers can elect not to contract out but to&#13;
run a private pension scheme. In fact, the purpose of the private schemes, whether contracted in or out, must be to provide additional benefit. This additional benefit can be some means of providing @ pension which relates to salaries over the upper limit of £5,500 pa, or Providing additional dependents pension, or sickness benefit, or lump sum payment on death in service, or some combination of these benefits. One additional facility which most private schemes offer is that a Proportion of the benefit can be taken on retirement as a lump sum. There is, however, one aspect where the state pension scheme will have an&#13;
advantage over the private scheme&#13;
There is only one state scheme. It does not tic an&#13;
employee to any particular employer. When an employed person who joins a Private pension scheme and subsequently moves after, say, five years to another office with a different private scheme the pension relating to that employment is either frozen or if it can be transferred to the scheme at the new place of work, there will probably be ‘administrative charges’ deducted from the fund which is transferred. Most Private schemes are fined by nominal cash amounts rather&#13;
than value, that is, the benefits are determined as a Proportion of te average of a small number of best years actual salary and the length of service. An employee who stays with the same firm for 40 years fromtheageof25toretiarndeismaememnbetrof the pension scheme will receive a level of benefit which probably will be determined in Practice by some of the final ten years, Ifthe employee belongs to one scheme for 10 years from the age of 2S and another scheme for the next 30 years he will make&#13;
</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="39">
            <name>Creator</name>
            <description>An entity primarily responsible for making the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2064">
                <text>Several authors</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="48">
            <name>Source</name>
            <description>A related resource from which the described resource is derived</description>
            <elementTextContainer>
              <elementText elementTextId="2065">
                <text>John Allan</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="40">
            <name>Date</name>
            <description>A point or period of time associated with an event in the lifecycle of the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2066">
                <text>May 1978</text>
              </elementText>
            </elementTextContainer>
          </element>
        </elementContainer>
      </elementSet>
    </elementSetContainer>
  </item>
  <item itemId="373" public="1" featured="0">
    <fileContainer>
      <file fileId="390">
        <src>https://nam.maydayrooms.org/files/original/4a52c88245272c062f4b4faaca058962.pdf</src>
        <authentication>8bdb13b55cd99fbf0189a3d790485536</authentication>
      </file>
    </fileContainer>
    <collection collectionId="7">
      <elementSetContainer>
        <elementSet elementSetId="1">
          <name>Dublin Core</name>
          <description>The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/.</description>
          <elementContainer>
            <element elementId="50">
              <name>Title</name>
              <description>A name given to the resource</description>
              <elementTextContainer>
                <elementText elementTextId="13">
                  <text>Trade Unions and Architecture</text>
                </elementText>
              </elementTextContainer>
            </element>
            <element elementId="41">
              <name>Description</name>
              <description>An account of the resource</description>
              <elementTextContainer>
                <elementText elementTextId="14">
                  <text>Themes included action on asbestos and Health &amp;amp; Safety, and involvement with Direct Labour Organisations and Building Unions. Following comparative research of possible options, NAM encouraged unionisation of building design staffs within the private sector, negotiating the establishment of a dedicated section within TASS. Though recruitment was modest the campaign identified many of the issues around terms of employment and industrial relations that underpin the processes of architectural production.</text>
                </elementText>
              </elementTextContainer>
            </element>
          </elementContainer>
        </elementSet>
      </elementSetContainer>
    </collection>
    <elementSetContainer>
      <elementSet elementSetId="1">
        <name>Dublin Core</name>
        <description>The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/.</description>
        <elementContainer>
          <element elementId="50">
            <name>Title</name>
            <description>A name given to the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2067">
                <text>Lucas Aerospace/ NELP</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="49">
            <name>Subject</name>
            <description>The topic of the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2068">
                <text>Notice for 1 day conference  organised by CAITS</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="41">
            <name>Description</name>
            <description>An account of the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2069">
                <text> CENTRE FOR ALTERNATIVE INDUSTRIAL AND TECHNOLOGICAL SYSTEMS CoA 15&#13;
ALTERNATIVES TO UNEMPLOYMENT -&#13;
NEW APPROACHES TO WORK IN INDUSTRY AND THE COMMUNITY&#13;
ONE-DAY CONFERENCE -SATURDAY, 18th NOVEMBER 1978&#13;
A one-day conference is being planned for later this year. It is organised&#13;
focus for information about recent&#13;
by the Centre for Alternative Industrial&#13;
producer co-operatives.&#13;
and Technological Systems as a developments in industry and communities.&#13;
LUCAS AEROSPACE COMBINE SHOP STEWARDS COMMITTEE&#13;
NORTH EAST LONDON POLYTECHNIC&#13;
Longbridge Road Dagenham&#13;
Essex RM8 2AS 01-599 5141&#13;
QO&#13;
The theme of the Conference is to a large extent concerned with the work of the Centre, but we hope most of the contributors will come from outside the Centre. The Centre itself is a unique venture in co-operation between the North East London Polytechnic and the Lucas Aerospace Combine Shop Stewards Committee. It exists to help develop the idea and the practical reality of socially useful production, especially in industries and areas which suffer from structural unemployment.&#13;
The Lucas Aerospace Combine Shop Stewards Committee have put forward constructive proposals for product diversification in Lucas Aerospace as an alternative to redundancy - the Corporate Plan. The Plan was drawn up from replies to a questionnaire sent to Lucas Aerospace employees, asking them to make an audit of plant and sheds and asking for suggestions for alterna- tive products. The Plan consists of six 200 page volumes, detailing 150 products in three broad categories; products which have social utility, but which also have market potential, such as heat pumps for house heating; products which do not have an obvious market potential in the conventional sense, such as medical equipment; products which have more long-term implications, such as equipment for solar and wind energy systems.&#13;
The Centre is not only concerned with the development of Lucas Plan products, it also has a responsibility for assisting the development of employment- creating initiatives in the Docklands Area, in particular, the development of&#13;
&#13;
|&#13;
 CONFERENCE THEMES&#13;
The preparation of ‘Corporate Plans! by workers in industries that are redundancy-prone.&#13;
Industrial conversion - top-down or bottom-up? Implications of industrial conversion for Trade Unions, Managements and Government.&#13;
20 Employment policies - industrial strategy and local employment initiatives.&#13;
What are the employment possibilities in an inner City area? What special features need to be examined and what are the opportunities offered by them?&#13;
"Corporate Plans! for communities?&#13;
What is the role of Trade Council's and Trade Unions in local employment initiatives?&#13;
Resource use and waste in industrial strategy - the local reality.&#13;
Jobs and Alternative Technology - are there real possibilities for long term job creation in the so-called alternative technologies?&#13;
Energy-saving, through insulation programmes could provide long-term employment, resource and social benefits.&#13;
Energy-saving, through re-commissioning of small urban power stations, centring on Combined Heat and Power (CHP) systems - could also provide employment, resource and social benefits.&#13;
Other ‘alternative! energy sources - wind, wave and solar-&#13;
viable and employment creating? e@)&#13;
Refuse - waste or resource?&#13;
Environmental protection and pollution control - money spinners or job creation? s&#13;
The future of work - will there be a dual economy?&#13;
Core and marginal economic activities - increasing fragmentation and isolation? a high-capital, high-wage sector taking the majority of conventionally viable product markets, leaving marginal, low-wage activities to co-operatives, municipal industry, voluntary groups etc?&#13;
Is there a viable role for management in the future?&#13;
Can Trade Unions break out of economistic activities?&#13;
What could be the future of the man-machine interface?&#13;
Are we stuck with the legacy of Taylor for all time - job structure - a constraint or an opportunity?&#13;
MG/MED March,1978.&#13;
he&#13;
~ maser&#13;
How can 'Corporate Plans' be drawn up by workers? - Trade Union&#13;
organisation/management reaction/industrial&#13;
democracy.&#13;
How to define socially-useful goods and services? How can you ‘market? socially-useful goods?&#13;
Is there a role for Co-operatives in local employment creation- O&#13;
advantages and disadvantages of Co-ops/small&#13;
businesses? :&#13;
</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="39">
            <name>Creator</name>
            <description>An entity primarily responsible for making the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2070">
                <text>MG/MED  ?</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="48">
            <name>Source</name>
            <description>A related resource from which the described resource is derived</description>
            <elementTextContainer>
              <elementText elementTextId="2071">
                <text>John Allan</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="40">
            <name>Date</name>
            <description>A point or period of time associated with an event in the lifecycle of the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2072">
                <text>March 1978</text>
              </elementText>
            </elementTextContainer>
          </element>
        </elementContainer>
      </elementSet>
    </elementSetContainer>
  </item>
  <item itemId="374" public="1" featured="0">
    <fileContainer>
      <file fileId="391">
        <src>https://nam.maydayrooms.org/files/original/d02a1f8a6dd8dabadc764422910e4972.pdf</src>
        <authentication>c9ee42f7dfa6c648724234f1c92923b6</authentication>
      </file>
    </fileContainer>
    <collection collectionId="7">
      <elementSetContainer>
        <elementSet elementSetId="1">
          <name>Dublin Core</name>
          <description>The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/.</description>
          <elementContainer>
            <element elementId="50">
              <name>Title</name>
              <description>A name given to the resource</description>
              <elementTextContainer>
                <elementText elementTextId="13">
                  <text>Trade Unions and Architecture</text>
                </elementText>
              </elementTextContainer>
            </element>
            <element elementId="41">
              <name>Description</name>
              <description>An account of the resource</description>
              <elementTextContainer>
                <elementText elementTextId="14">
                  <text>Themes included action on asbestos and Health &amp;amp; Safety, and involvement with Direct Labour Organisations and Building Unions. Following comparative research of possible options, NAM encouraged unionisation of building design staffs within the private sector, negotiating the establishment of a dedicated section within TASS. Though recruitment was modest the campaign identified many of the issues around terms of employment and industrial relations that underpin the processes of architectural production.</text>
                </elementText>
              </elementTextContainer>
            </element>
          </elementContainer>
        </elementSet>
      </elementSetContainer>
    </collection>
    <elementSetContainer>
      <elementSet elementSetId="1">
        <name>Dublin Core</name>
        <description>The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/.</description>
        <elementContainer>
          <element elementId="50">
            <name>Title</name>
            <description>A name given to the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2073">
                <text>A Union based Initiative</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="49">
            <name>Subject</name>
            <description>The topic of the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2074">
                <text>Role of Unions - Case History from Hackney</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="41">
            <name>Description</name>
            <description>An account of the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2075">
                <text> ne0NebON.BUASED iNeiotbALTaVe LN AC KN EY&#13;
DRAFT MAY 1978&#13;
&#13;
 ROLE OF THE UNIONS - CASE HISTORY FROM HACKNEY Tom Bul ley May, 1978. Notes for NAM Conference, Birmingham, 6th May, 1978.&#13;
PREAMBLE:&#13;
- autonomous intervention, not incorporation through consultation THEMES:&#13;
Take your own current job and conditions seriously, make connections and overcome barriers using existing democratic means; when blocked create more direct forms of access to power under democratic control.&#13;
THE HACKNEY STORY:&#13;
' A case history of attempts to relate trade union activities to the content of work, and to develop inter-union co-operation in one London Borough."&#13;
BACKGROUND INFORMATION:&#13;
Hackney and Hackney Council Union structures Nalgo&#13;
Management structures Direct labour force Building management Architecture and Planning&#13;
Building Programme (lack of) History of the Problem Struggle for jobs&#13;
Democracy as a precondition for democratic design.&#13;
Democratic design as an immediate social need and expression.&#13;
Forms of democracy&#13;
Design as a social process Democratic management&#13;
&#13;
 Feb. 78:&#13;
Mar. 78:&#13;
Apr. 78:&#13;
UNRESOLVED ISSUES:&#13;
Postponement of Joint Working Party Meeting Partial revival of Dept. Working Party Unblacking of ACHO post (or not).&#13;
Reports to Policy Committee.&#13;
Scramble for Staff.&#13;
Policy Committee.&#13;
Leaders Panel (HIP).&#13;
Leaders Panel (Partnership).&#13;
Departmental Meeting.&#13;
Unblacking of work to Consultant Architects {or not).&#13;
Planned building programme Corporate Programme&#13;
Borough Plan&#13;
(and the struggle for Planning) Client roles in design - institutional&#13;
- direct (i.e. users) Producers' contributions to design - in detail&#13;
- in concept Worker's Alternatives (alternative plan)&#13;
CONNECTIONS TO BE MADE - OR DEVELOPED:&#13;
Tenants groups&#13;
Residents groups&#13;
Community groups&#13;
Research groups&#13;
Pressure groups&#13;
Political groups&#13;
Activists&#13;
Councillors&#13;
Hackney NALGO / other departments Joint Hackney Unions&#13;
NALGO / TASS&#13;
Building Workers Unions&#13;
Other local authorities architects Private architects&#13;
NAM&#13;
Community Architecture-&#13;
</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="39">
            <name>Creator</name>
            <description>An entity primarily responsible for making the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2076">
                <text>Tom Bulley</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="48">
            <name>Source</name>
            <description>A related resource from which the described resource is derived</description>
            <elementTextContainer>
              <elementText elementTextId="2077">
                <text>John Allan</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="40">
            <name>Date</name>
            <description>A point or period of time associated with an event in the lifecycle of the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2078">
                <text>May 1978</text>
              </elementText>
            </elementTextContainer>
          </element>
        </elementContainer>
      </elementSet>
    </elementSetContainer>
  </item>
  <item itemId="375" public="1" featured="0">
    <fileContainer>
      <file fileId="392">
        <src>https://nam.maydayrooms.org/files/original/b4ead56ad1e9ea831b503cb1bf992cf6.pdf</src>
        <authentication>6e1982906eb25895a8f975e3847c9e50</authentication>
      </file>
    </fileContainer>
    <collection collectionId="7">
      <elementSetContainer>
        <elementSet elementSetId="1">
          <name>Dublin Core</name>
          <description>The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/.</description>
          <elementContainer>
            <element elementId="50">
              <name>Title</name>
              <description>A name given to the resource</description>
              <elementTextContainer>
                <elementText elementTextId="13">
                  <text>Trade Unions and Architecture</text>
                </elementText>
              </elementTextContainer>
            </element>
            <element elementId="41">
              <name>Description</name>
              <description>An account of the resource</description>
              <elementTextContainer>
                <elementText elementTextId="14">
                  <text>Themes included action on asbestos and Health &amp;amp; Safety, and involvement with Direct Labour Organisations and Building Unions. Following comparative research of possible options, NAM encouraged unionisation of building design staffs within the private sector, negotiating the establishment of a dedicated section within TASS. Though recruitment was modest the campaign identified many of the issues around terms of employment and industrial relations that underpin the processes of architectural production.</text>
                </elementText>
              </elementTextContainer>
            </element>
          </elementContainer>
        </elementSet>
      </elementSetContainer>
    </collection>
    <elementSetContainer>
      <elementSet elementSetId="1">
        <name>Dublin Core</name>
        <description>The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/.</description>
        <elementContainer>
          <element elementId="50">
            <name>Title</name>
            <description>A name given to the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2079">
                <text>TASS News &amp; Journal</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="49">
            <name>Subject</name>
            <description>The topic of the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2080">
                <text>TASS Newspaper</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="41">
            <name>Description</name>
            <description>An account of the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2081">
                <text> “tas Low wage |TASS policy&#13;
must end&#13;
JANUARY 1978&#13;
news &amp; journal&#13;
I would like to take this opportunity to wish all members and their families a happy and prosperous&#13;
a&#13;
Low wages have not helped our economic position; they have made matters worse. The demand for goods and services has been kept low by depressed wages. The result — unemployment. Today there are&#13;
1% million without jobs. That leads to a shortage of money and that means that goods lie unsold in factories, warehouses and shops. Redundancy notices soon follow.&#13;
Not only do low wages cause unemployment. Wage restraint has failed utterly to reverse the dis- astrously low level of investment in British industry. The argument that incomes had to be restrained to permit resources to be diverted to modernise British industry has been exposed as the sham it always was. A recent table in the Economist showed that between 1955 and 1975 Britain had the lowest level of in- vestment of the leading tenWest&#13;
¢ weoplel&#13;
bts&#13;
tak&#13;
7) plens of Levande) Hxecutive Mike E urnblaert :&#13;
~&#13;
num of&#13;
clusion w!hich“emerges from any comparisonbetweenwagesand Sets salaries in Britain and other ad-&#13;
vanced industrial countries in&#13;
Europe.&#13;
le&#13;
Du&#13;
iS a col&#13;
gAUEW (TASS) SALARY CENSUS ffl -J&#13;
in the Cars Division.&#13;
So far as TASS members are concerned it is ludicrous to&#13;
European countries. If anything investment was even lower during the social contract.&#13;
So what has happened to those wage increases we have sacrificed? If the benefits haven't gone into British industry where have they gone? They've gone into the pockets of the employers in increased profits. And they've been frittered awa, in overseas investment,&#13;
helping overseas competitors and adding to Britain's dole queues.&#13;
Expansion&#13;
This disastrous farce should be ended. There must be new policietso expand and modernise British in- dustry. The revenue from North Sea oil may be our last chance.&#13;
THE TASS SALARY&#13;
membershi&#13;
soared&#13;
a 1978, would also like to thank all active members, including the Executive&#13;
ITISTEMPTING totreatasajoke recentspeechesfromseveralTHERATEOFGROWTHofwhichleadsustobelievethatployedbyTASSforthe Ministers indicating that wage membership of TASS during we can achieve not only our unstinting work they have increases should be kept to 5 per 1977 was greater than the aim of a quarter of a million put into the Section in 1977.&#13;
cent in the next phase. sum total growth of all the members by 1980, but an other white collar unions in interim target of 200,000 by But kite flying is intended to engineering put together. Our this year's annual conference&#13;
After thanking you all&#13;
could I now call on you for&#13;
more effort in building the&#13;
Section? Our membership ix&#13;
now 182,000. I have one done, Help me to achieve it ambition as President and Help yourselves by naking a that is to preside over next strong and effective Section&#13;
evoke a response, And we shall be rate of recruitment last year failing in our duty to our members if was ten times higher than it we don't make clear our absolute was before 1971&#13;
hostility to such a proposal. TASS is now the foremost&#13;
in May&#13;
There are still 40,000&#13;
qualified engineers who don't&#13;
yet belong to a union. There&#13;
The trade union movement has for white collar union in aero- are about 100,000 year's RC Conference with even stronger and more&#13;
too long acquiesced in a policy of space and shipbuilding. The unorganised managers in delegates representing effective&#13;
holding down living standards — a policy of wage restraint dressed up originally as the social contract.&#13;
The current limits on incomes have been unilaterally imposed upon us and it is high time the TUC stopped dragging its feet and said so.&#13;
Cheap labour&#13;
new publicly-owned bodies in engineering; and hundreds of 200,000 members. It can be BOB MANSFIELD. aerospace and shipbuilding thousands of clerical workers&#13;
have recognised us as who ought to bein TASS.&#13;
representing all staff — The four-page centre pull-&#13;
The policy of low wages is com- pletely m iedie ected. British labour is&#13;
achievement for TASS. The members that t ir interests JOHN ROWAN, National Industrial Officer, was, as this issue&#13;
labour. That m: i&#13;
da.Itisthat ing. AShasSalreadymadeplainitsopposil&#13;
‘Leyland sackings&#13;
figures given in this issue of lie in joining the most effec- went to press, involved in top level talks on the future of TNJ are facts, not tive white collar union in&#13;
here is no such pretence now. clerical, technical and out in this issue of TNJ is&#13;
managerial designed to be used as a From a wide range of jobs poster and put up on your across other sectors of the notice board. Its purpose is to engineering industry men and provide facts to our active&#13;
‘wil be resisted&#13;
women have been joining us. members: information for&#13;
1977 was a year of solid them to use to rsuade non-&#13;
eee&#13;
po NOT FOLO TS Foe&#13;
Pressewriebeigacerprovidedandmat darashertextadybepenedasappreeca’e&#13;
5 (a) Aen you 2traicen oeapprentice7&#13;
{R) 01CSpeasewastelengeofarperieneemew&#13;
Tdeeyou aTASS emer?&#13;
census form&#13;
invaluable. It has meant, for CENSUS is the only one example, that TASS has been&#13;
thinkofsackingswhilstmillionsofpoundsofdesignworkis bei: laced on the continent by Leylands. TASS has reim- ts ban on design work going out of the company, It lifted&#13;
produced by any trade union&#13;
in Western Europe. It is the&#13;
most detailed sunvey, of engin-&#13;
eering staf wages from any claims. 7 5 cael including even the The more replies we receive, Government. the more effective is the&#13;
The first requirement is for the&#13;
trade union movement to refuse any&#13;
longer to condone low wages&#13;
whether dressed up as the social&#13;
contractorenforcedbytheTories The purposeofthecensusisinformationonpage12and rigid money supply policy. Tofight to improve theyeamee and con: emnesmubrer tahtat youerveryworkTplAaScSe&#13;
for higher wages is to serve the ditions of TASS members. fills in the questionnaire.&#13;
national interest.&#13;
‘The information it produces is&#13;
able to use the information it ovides in a number of ighly successful Schedule 11&#13;
survey. Read the detailed&#13;
-ommittee, full-time of- ficials and all staff em-&#13;
its earlier embargo to enablea Government inquiry to establish the facts. The Government has not yet fulfilled its promise to investigate.&#13;
Toirub salt into the wound, wages paid to do the same work on the continent are four to seven times higher than our members at Leylands are getting and skilled design teams in Britain are being broken up through the Government's low wage policy.&#13;
The TASS embargo will continue whilst jobs are threatened. These lunatic Leyland policies st be changed&#13;
Christmas fare— with alittle help&#13;
friends&#13;
New Year message from the president&#13;
Vag BOre&#13;
.&#13;
1Sad Presne mart apprvprabemr wee tenes&#13;
| ee. |&#13;
3Salary Passe wate wis! woahy nmrent esukusive of anyereveme ar Danes ree&#13;
|&#13;
: A «Al,&#13;
=le e a ies&#13;
ELD -40° Taseweat toy&#13;
General Council who voted for TUC support for the firemen.&#13;
from their&#13;
hat the families of firemen on strike East Anglia divisional president, deliver a&#13;
Filinyoursalary&#13;
TASS members all over the country made collections and&#13;
menerout Sony Christmas. Seen here Ron Borrett, EC (right) and Bill Grant,&#13;
hamper of goodies for thekids.&#13;
Ken Gill, TASS General Secretary, was one of those on the&#13;
&#13;
 coors&#13;
gees ers&#13;
onc E upon a time in a demanded mostof itin tax &amp; ‘ &lt; , M&#13;
on the formative cocmepnatnrya.l&#13;
SeraSofaetrainedstaf NuffieldPreas,,whichis eee&#13;
bottleneckp.e Teoaevoeid this, | rheoyuisaend; Brepartienotidng whicfhor ?22,100by 1986. FAsSisconpercngresy|mnfcureindutralTASSgrows&#13;
sete. [a nquiriesintotheirpay,conditioenasrsandttshe aaa a aera SR UIGER su enjoyed my stay at peenetaraofthefireservi emostrecentwasaf—__ —— “Caplene-Ferne”Cosn:&#13;
ae&#13;
1966 the&#13;
firemen pave&#13;
had no les:&#13;
°&#13;
po&#13;
r&#13;
t&#13;
e&#13;
d by the union.&#13;
working group under the chairmanshi of Lord Mc- Carthy. tesoughttoevaluatethequalifiedpan s ob in relation to others in the communi Re The fin-&#13;
ony, 2 valescent 7&#13;
actin ae eecomen ete] earings of all adult males, then standing atPer 8.08 a&#13;
RACISM&#13;
a ext were&#13;
maleearningsplus10percenttotakeaccountoft&#13;
Ver&#13;
Iae liketorecomraedtothe10per 7perniciousadvertisingby&#13;
Onegrouppreparesevidenceformocknegotiationsonpalin&#13;
wypheirchattootkhepGlarcaendlateToltals,tteinnctoinugntefrorbewttherntraniengion-gbeaecnkgroupnrdeparemda.teriaItlwhasd was a most instructive generally agreed that al&#13;
eralCouncil&#13;
causeofblod being,shed R.E,HUTCHINSON |on scale 01&#13;
R aterhapeyialakGane ane as&#13;
oetotradeunionac-groupScnlththetopicofwentwrongcouldEatiny Housaholalirems afast¢ne.OE itsprofi Oetatee,hewassnidtobe&#13;
sa&#13;
inDecember, coieaaenehe risk of&#13;
f&#13;
Eee e mo&#13;
e&#13;
A Grimm fairy iene the 1. The wordsblackand&#13;
pcvoven| mieten starilivedproperty&#13;
een ee Peres | PipskersUnions axes eb the contestants knew.23 | were unequal&#13;
tarot&#13;
wee of skiled of| Special Products;&#13;
sto of two&#13;
|&#13;
arebasicallyinsulan So-called” 9 coe&#13;
are al ad:&#13;
ficult&#13;
son women | extraordinary hoteh- tena, Last seers £16 technicalities of such&#13;
iene a cae&#13;
Mfcams|Nationality,ClaseorwHeletderiDnecgemb'ers|terbetom’s, leter Gy"yelthesofbers feaa&#13;
the village came and made al 5 2&#13;
:&#13;
shoes and || regimentit’s fighting eel[eesteneneesfiaheinsae&#13;
ee&#13;
has failed the By turnover, Leyland Asissooftenthecase Sector hasfa wl&#13;
Srunwicks&#13;
ee es&#13;
,&#13;
bet ord alt&#13;
aivayswanted.callviteorBhaneforour colourcatalogue&#13;
Since whendoes neneed | ations!” tos&#13;
screenbeingsat tworker helpal‘owerpals‘People, seVerylitleo a ye tradeunionist,Mr.Gough,&#13;
Youaweittoyourself!&#13;
alma&#13;
paying taxes Toadandest&#13;
oducts Division are whictiniy|theapiviaicn's sensefor tee civienita Aveling Barford, Aveli headquarters. fold,&#13;
enplovee&#13;
% Peherewasbuoynleyeanonoetlweay&#13;
thanmachine!Pre e) Sorry” were back&#13;
ShoemakerOnetohis started,onlythistime employee, “but business is paid taxes on two business For a while redundant workers each.&#13;
Senacsand’aman Importety.Bayram&#13;
struction and agricultural car manufacture there contribution to Britain's uipment. And finaly and making 3,000 publicl owned&#13;
erOnedidquiteNexttheytriedto.un: wel because by under dercut’ each other by&#13;
PeanedetalDarelrectoranelerlaSRSA poebentneeweber&#13;
heincreasedhisshareofprofitsuntilShoemaker&#13;
Wipers,furnitureandfabcicsbyaleadeo ; Bee&#13;
Which manufactures yearold wiz kid witha "As John’ Rowan,&#13;
: neapoint |&#13;
to popularise breast&#13;
5 ri Dyers etal =&#13;
GERARDCOLLIER aN&#13;
a&#13;
hikedup the prices so that Meee tinea Hedidn't live aswell as he had hoped because he had to pay the wages of a taxman and dole money orm four&#13;
redundant employee&#13;
Moral: Not all airy tales&#13;
iS&#13;
in&#13;
are fairy tales&#13;
Sequel. For anyone who&#13;
thinks that extra em- ployment, was achieved in juction of shoe&#13;
iiS&#13;
oe oonee there|relyhelped&#13;
machines, IT have another Once upon a time there&#13;
to tell members reo rom @&#13;
enforced back to work. It’s true&#13;
FEE eee alenmunitment tofutureim-||IWOULDlitokcoemment|theytakeytheiroptionto annualnereaneecwasdueinoeProducts,bysvi&#13;
ovements which they wouldn't have got otherwise. || on the background to your this benefit provided by| September 197; |.stding| thatbottle fed ving juttheydesetherirvclaeimdnow reviewofthe ° 7 vilb eos orritten|AWaa leailia&#13;
een&#13;
white should never be used&#13;
Costs more than breastfeeding(cost of mall,equipmentand&#13;
Campaign&#13;
TASS is spearheading a |\the .&#13;
|&#13;
he&#13;
todescribe‘pole—they&#13;
mipawemen tingtothe clakckoftain asmajor r the women matlor&#13;
i for|threeLeylandDivisions. Hageunioc‘otmumnitieswith Special Products is&#13;
ear icularlyskilled ae technicaltaff—andthatThatsellitngftofSfacorulidsbe&#13;
Whisihelwascountingexhauwaedtstiarvoatnion!&#13;
hisprofitanoficialfrom ShoemakerTwonow|Ifthere'sonething|wilnothaveinmy&#13;
Gisinprolmasetyings.Alour&#13;
tohel focralvcaorypatsthroug&#13;
s&#13;
| i&#13;
Teecereonneree:I]Judith! Hunt, “TASS National Women’ eared Siscaliongoer Geemneataa SHateininduastnryalafter CruaniserLelen|CowanChalnwomaniorensordertotoisupplyplant°HivingOff?—industrytheprivate&#13;
ecientCHARIhereon Marsiand,AssistantGeneralSec:taryofthe&#13;
30&#13;
COHAR tiitences&#13;
Pee ee Dept-TASS eisO74)278, pelvonese omewxcalrzmsCant WeacceptBarclaycard,AccessAe Si&#13;
one'smind?Frespechis! believe&#13;
Stil i allowed SinieBritain re pyicience and anarchy.&#13;
todayalthoughsocialists Having.saidthat,1do profiteeringsectorofour donotrelectmyopinions seemtodislitkheisfact believeintreatingviolence society exploiting the Thisisthereasonwhyso&#13;
Glangewe Conary Csngee Fematong&#13;
Contact:&#13;
e&#13;
or an&#13;
f&#13;
=&#13;
cra cea an Te le&#13;
tal cae&#13;
BUYING JEWELLERY? ;&#13;
oftheUtetntotsithtaed oshavebenrumours 7table,guarantesjob&#13;
3&#13;
4 tanibiteSticlose. eaePrepareteosw&#13;
neige|potehofcompaniecsa,ch"illlonwasinvested Sbloan anticipated:economic.|name.“YtincludsetheSteadyex;&#13;
ey, Se&#13;
RS wnat wa a Leyland Special&#13;
Rea&#13;
:&#13;
C&#13;
% hy staiyn&#13;
O&#13;
R&#13;
Y&#13;
Nh |cesssene&#13;
|BrySee —‘AS_AMEMBERofofthithe Fy&#13;
relationshipbeeen ergo&#13;
Masteringcone viouslyourbrainsareal|mite for1.C.L.mayI&#13;
Siete are ienportant.&#13;
Pete nh foe|Base:&#13;
coloured). Groups cen correct some of the&#13;
‘One ribed by the terms| inaccuracies in Mr IN REPLY TO D. Win-&#13;
sta,er&#13;
itiesoftravewlil||Firstly, the|1-C-L.|isue,ofcoursewomencan (aealacaitionalcot SeeTanaLRA ofan| jucea worldinwhich|scheme does contain a|makethedecisionwhether "itminorityofcases inthevilageneded.I paytowardstheoficial'sdifferingpeoplesare|guaranteed10percent(12|tobreastfeedornot.But herethemotheris&#13;
&gt; theunion'spdoelimcoy!crwaacgyes, 2“094u,t,thberenaudmtbhoefr,trqauianlintgy|cTonydliatnidonvse;hiclesScainmmarecltlic AstheDivisionexpands, ailndtuesrtnraitailve economic staf. Trailers; Coventry 50TASSgrows withinit. Policy,racialismandinter- “Materialsforthene Climaxforklttrucks:TASSmembership‘hes&#13;
st Saidictaprealto&#13;
r&#13;
thenumber ofhourstheir employeesworkedand h the number ofshoes&#13;
nationalpolicy. tiatingexercise ThewholeweekendhadQuizareavailableinowChmaknegsinautoGmeatriscwtrhaincsh-months. visionhas&#13;
celtaem&#13;
they produced. Neit&#13;
broughtclosertogetherin|percentover14months)|deci based on}inpeer ganetiabled|wichieeemekey an|knowledge and ifthat are&#13;
andthe tanks;and increased7loverd1b)per&#13;
olivein,ahomogeneous|increaseinturnovoefr10|knowledgeIsbasedupona ape&#13;
pos pen ec e i vious|ant loctrination, then the cam) sign&#13;
centinthe fasta&#13;
a&#13;
would they agree tocharge make him think it was yDIG years, turnover has| of financial gain, surely it&#13;
tatenounhtp|resultofintermarriag year,Ineachofthepastbymediamenforthesakewouldnotbenecessary.7&#13;
beenexpertlyplanned.The|iromTASSHeadOffice)|missionsforbuses, afederatedstructurebutItmakes boats, trucks and trains lately it has been&#13;
Sould-aswelworthwhile,Thatwasuntil| LENDIGHT|risenattwithicsreate, istheduty'ofthetradewomenandbabieswil totheShoemakerTwoboughta|&gt;—— ——_—__—_——, |unionmovementtotrytoallbenefitfromtheTUC&#13;
—‘ineludingBritishRail’sdevelopingmoreand sense igh-speedtrain. mimoargee.ofItsaincdoursptoriaatle WhileSpecialProducts&#13;
machine, sacked his em ployeeandproducedas many.shoesasShoemaker One.Thisbroughtbothof&#13;
redress the balance. action onthis subjeacndtI Oneofthemainreasonsaaalltradesunionisttso&#13;
is an extremely, diverse Aveli rtreollalteidonscentproallilcytihsr.oucgohnDivision,Leyland’smain&#13;
;&#13;
PLEASEallowmetoreplywho ispoliticallyfedicineandsquealwhenthisso-called&#13;
toJ.P.Gough(November) motivated: it TNJ theygetsomeofitback mt ed working| Briton2Inyaltonin Gute Chane&#13;
DONTAEAGUE10&#13;
milion,“ofwhich£70Productsbacktothesecurityandabigsayfor milion’ were exports rivate sector. yn staf workers, then an expanding public,sector&#13;
ping : J man’s government in- atackingmycommentson whichcynotseemto,No BythewayIamnot ‘oducedabasicminimum&#13;
B yay)&#13;
COUNTS!&#13;
BotoaRRUproh bel nwekayn vou lhare[||| Soumzienmosion Soreken97trvlewredl hy”&#13;
y not ; addictedtomytelevision ade.Surelythis,would&#13;
making,itone:oftbe Bavideo Nee istheonlyanswer.”&#13;
withviolence(likebirchingworkingclas—ohgawd!fewofmycoleyiescanbe YesIknowthedifferencefootballhooligans)astheseDon't =&#13;
betweenanM.P.andonepeopdolnoetIliketheiroewnraMsr.GouGgohloitdiesnavbeourtoetiemeaaaaaeaaeRitts|&#13;
As for the one aboutthe and you and the TNo&#13;
{anetOionSetS&#13;
EdinburgaFredericaSt,0.257204 IMETRACO 250,KINGSTREET,LONDON.W.6.&#13;
=&#13;
ulisingseit&#13;
attheschool. D1r2eeReaeinlwdaiynceTeraracae,Resby, TobaccoWorkers’Union,&#13;
Special ove, alaine SLonemacctlonsiaol and the work- cighthbigest,company Rationalised industry wearetobuilda beginto lokprofitable, ing,industry&#13;
TASS News &amp; Journal January 1979&#13;
TASS News &amp; Journal January 1978&#13;
vase was ducin| manufactu: a&#13;
claiirmeidnghbaym,alasagreatexperience. theefforthadbeenBenth ‘Thefiremenhavebeenmadethescapegoatofthe}|DiTsadmvantaogledinenBoruitgahin’to}PeeaGweTAYLORwilhaverecei, celendal(tbheycausfeor Success.SixtywomenOnSat hil i&#13;
Secaees Congrespolicyaot]|rememberthesocaled| racial theories’ emanating&#13;
rone a7 he K Gil supported the firemen on the TUC || and ‘40s whieh were a&#13;
pointsfromthedivision,|_reslatantcoeinfection ; : AnAUHGe to ehUdaei&#13;
atendedand.”since"amembeafrNsoo15DirHunt,"TASS"Nations; special effort had been sion joined the women to Women’s Organiser, and&#13;
shou :&#13;
selvestothetruthorake Causesextraworkfor&#13;
newcomers, more than half performance of the Mon- deserved many it WwereeithernewtoTASSorstrousHogiment‘theatretions.‘Theonethingtha|ALTHOUGH BuusH eyearners. mingham Postlast&#13;
ivity. ‘womenai ave been attributed to and) ‘rose from28.4millionto SSglarly unmoveedbry Toavoidtheeyre‘orwillnowswallowhi:themilkandcleaning “TrainingforBetterJobOnSundhiuman_failin bout2114£14mili”onandthotalkthati&#13;
|&#13;
novel approach in&#13;
ne hereceived&#13;
re 2ate rs&#13;
0&#13;
Division almost 14,0. Just over gut the Car Division. He&#13;
: cigsanddonnfio|eandeeringbate&#13;
Opporsnibe’Prasie&#13;
s ructutreu&#13;
putforwardforacampaign supportit.&#13;
veling Barford&#13;
P’RacaE ereTeaceavitfiaectuarer.eiconic&#13;
scalDirector,fromtheMelton makesalotofindustrial jpecial +Mowbray huntin, tl&#13;
a Sometimes results in This wi&#13;
Foley&#13;
FAS eneyor.and]bMteatyant TCT|Readlined,“Womens Stualmikey =) pcelateryeveneTeaerjon.rentselemployeale|mea ee Withit&#13;
roles u rr4.0)8 10)on rat&#13;
;&#13;
ngShoemaker‘Twotakingsmalerandsmaller TuBarbicanFurnisCehntirnegwehaveacomprehensiverage aetndesphaltplantwellknownpassionforNationalIndustrial&#13;
auneMourn staid&#13;
bnistoL, ne Yaua&#13;
sales totallin about seling Special :&#13;
y&#13;
a&#13;
S&#13;
t&#13;
r&#13;
e&#13;
ne st&#13;
w&#13;
arri toftheSUHniAonE”. dpartenchadedbeetnhae&#13;
tfooy ann;gedpi&#13;
r}|S‘pHeScialProducts tute tsem&#13;
yes&#13;
i&#13;
Sa&#13;
m&#13;
g&#13;
T&#13;
n&#13;
D&#13;
l&#13;
c&#13;
t&#13;
iv&#13;
isio&#13;
Barfords The Executive Director But the argument Belton whichproduce a of a ial Products is against hiving of hugeon con David Abell,whotook deeperthanthis.Ley!oaid movers, du: cks, over eh 1976, soon after SpecialProducts is h1igh roadSoaresaa carriedoutatechnology,highvalu tractors, plou; ee seed hatchet jb for Leyland in added aes As een drills and other con- Australia, terminating it can make an important&#13;
Marahalland&#13;
9&#13;
,0&#13;
0&#13;
m&#13;
i&#13;
o&#13;
l&#13;
p&#13;
Profactsche Soc to lor £200 millic bai&#13;
m&#13;
e&#13;
l&#13;
is stil&#13;
in&#13;
tHsalt essan&#13;
a&#13;
BYOU HAVE YOUR SAY&#13;
TrainingirASS women COMPANY PROFILE rica&#13;
“Two McCarthyReport,uponwhichthefiremen’s saertatitonoryy with,aaal&#13;
e1 diet needs catered for. Those are pl&#13;
cio Gonle T~RE&#13;
Stated inreas'a)gro Seely.Wegaet S e Ss The.varied recreation| originalsatheadoficeforreference.&#13;
£65.70 for a 48-hour week meant a take home £43perweek. ‘Thefireman'sclaimwasforaverage&#13;
i&#13;
ma&#13;
ae&#13;
ping the hstandardandcovered|= a1 increases| feding wastocombatthe&#13;
facilities we&#13;
re o! eo&#13;
—&#13;
ru 0ar&#13;
ne PN&#13;
RITES Ty&#13;
a Leyland cars, trucks and buses are a&#13;
household name. Not so wel&#13;
are the multifarious fntoheetes See Leyland Special Products Division: earth movers, self-changing gears and agricultural equipment —ail making up&#13;
a healthy £160 million sales.&#13;
ange of responsibilities and skils modern firemen&#13;
Se Tyme ere a the dried milk manufac mend to any aes byTASS in|turers.&#13;
requireandthehazardstheyface. feisadisgracethat,this,reasonableclaimwa&#13;
sonable s&#13;
fortunate enough to hegoti ;: THE TASS Ni It shi 7" needconvalescence|thatreeformemberswhose}|Ifthesedriedmilk Women'sWeekendShoalfalswhichreabeenlfesloraOndjdeteied orse 0&#13;
teIoup&#13;
Government's pay policy. Itisadisgrace that they did confirmation of both these&#13;
insuportoft nment’s10% &gt; ae I eased that our General| | from Ge&#13;
ete inedthe women to Women's Organiser, and&#13;
8&#13;
:&#13;
e&#13;
&#13;
 Page Four&#13;
unionists has&#13;
provisions for time of. "This in how the Code sets&#13;
(¢) Appearing on behalf making bodies.&#13;
takeadvantage oftheCode by claiming Umeoff from their employers for union ions,trainingand&#13;
industrial&#13;
OvatCodofracictebas&#13;
cation.&#13;
Code lays down&#13;
elections.&#13;
unions like TASS who are ‘on behalf of members on include:&#13;
matters of grievance or {n) Meetings 0!f the&#13;
Time off for&#13;
trade union duties and activities&#13;
THE CODE of Practice&#13;
covering time off fot de entitled to demand the new discipline. union's official policy&#13;
before an (b) Other union meetings such as an which need to be held in&#13;
that is, any elected ployees. representative, such as a shopsteward,isentitledto&#13;
Fou can, use the Code to pay to carry out trade&#13;
negotiate better union duties. These duties The oficial is also en-&#13;
out your new rights: @ Duties&#13;
of members outside&#13;
tribunal. working hours. (f)Explanation about (c)Representing the the role of the union at the union on external bodies A trade union official — workplace to mew em: auch as committees of&#13;
minimum standards. If reasonable time off with @ Training&#13;
®@ Advance notice&#13;
arrangementswithyourinclude: titledtopaidtimeoffor Membersandoficials Manywelorganised (a) Collective bar- training,toincludeinitialwhorequiretimeofare members have gaining. training on appointment expected to give notice to persuaded their (b) Informing members and further training to management ax far in&#13;
ICE&#13;
erstoalowtimeofabout negotiations orcoveradditionaldutiesor‘advanceasisreasonable&#13;
with pay for educational consultations h new circumstances,&#13;
‘They should explain why it ix needed and how much&#13;
sessions about the union, management&#13;
@&#13;
Union activities&#13;
time is required.&#13;
entirely controlled ani (c) Meetings with other&#13;
These would normally Not for industrial&#13;
staffed byTASS. i union officials on matters The Code of Practice is rial&#13;
Include accommodation for&#13;
meetings, access to Employers are not telephone, notice boards&#13;
and, where the volume of obliged to grant time off to workjusti jesit,theuseofmemberswhoareengaged office f ties. inindustrialaction,&#13;
‘The active participation point of of workers in their union guidance” in encouraging may create special dif- employers and unions to ficulties for some workers.&#13;
For example the Code&#13;
highlights the special&#13;
problems of married statute mig!&#13;
women face: with and the Code&#13;
domestic circumstances, “guide”itwillremain¢! and the special com- joint responsibility of municwaotrikoenrssdifficuwlotireksersofermepalcohyers saantd uni&#13;
eciploved in scattered or atgreoemdetnuhtecsnew provisio1&#13;
an important advance i&gt; trade union rights. Strong organisation wil enable&#13;
Trade union members&#13;
are entitled to reasonable&#13;
time of (though not Employers are expected&#13;
youtomake thebestuseof their em- it.Itisonly members o}&#13;
necessarily with pay) to to provide reasonable jon facilities to enable o!&#13;
recognised independent {d) Interview: with id activities. These may ‘ofPractice?&#13;
1977, failure,byanemployer,tothereforewillhelptoavoidgov‘emrpnlomyenrst’s,TheinfJeBdreirattisohn some of the ‘oblems&#13;
IN NOVEMBER,&#13;
Practice on Time Off for y the statute. The C&#13;
which might otherwise (sniogwnedCBIa)n and t ic&#13;
TOAST provisions.Ttpas,ineffeck,Wht theBeasisebySsRee ippe RO&#13;
came int ef cumstances&#13;
ts&#13;
industrialtrainingboards. (a) Voting in union&#13;
Sreintnonof lechMounotParent&#13;
B@ Facilities&#13;
action&#13;
to carry out their duties.&#13;
isolated locati&#13;
reduction of pune Tong ago as 1963 which "In pr in an effective and&#13;
the statu! statutory provisions. iaiPameret necesarytomet mutually satisfac!&#13;
manner. Anditis. A Parties) (iat the primis StatstoryprovisionsoftheHighwayCode. betweendifferinginterests Government issupporting situation. The Code esponsibilimutsyt always&#13;
meintoef aAprile aioeastiesa5)te) definition, a compromise&#13;
p 0 The Emp! it also an im- the statutory provision for&#13;
therefore&#13;
establishes&#13;
a res&#13;
set Pomether with the Protection Act. allocated tant development in the time off for training with a Code the statutory the task of oducing the levolvement ye towards the cost of toCodestoACAS.wee sibilitytotheinstitutionsthetrainingcarriedoutby&#13;
Irish members&#13;
win increases&#13;
ACCOUNTANTS at Bord but in their case TASS is na Mona, Eire’s State stil trying to negotiate owned peat factory, hourly payments for received no payment at al overtime.&#13;
ave a major impact upon their representation on t directly concerned in in- the TUC and_affilia' the rights of 300,000 shop Council of ACAS the TUC dustrial relations. unions. In 1976/77 the&#13;
grant was £400,000 and for stewards and other trade and the Confederation of ACAS has now produced the current year it is&#13;
TASShassetitselfatarget:tobuildourmembershipfromitspresent183,00to0aquarter of a million by 1980.&#13;
Thattargetisnopipedream. Thelastquarterof1977sawaremarkableupsurgeinmembership which brought that 250,000 well within reach.&#13;
union representatives. British Industry have three Codes; the first £650,000 of which £10,000 An ACAS Code of therefore played a major to Disciplinary is to go towar short&#13;
Practice does not in itself in achieving a Practice and Procedures courses organised by af-&#13;
filiated unions. Whatit says&#13;
create law; itaims to set a cceptable set of&#13;
general and reasonable Each of the&#13;
standardagainstwhichthe ‘odesisprecededbythe °&#13;
statute can be applied in publication of a con- Collective Bargaining. This specific circumstances. Sultative document and the&#13;
ither does it strictly careful considerationof al third Code on Time Of is&#13;
impose any legal the resulting submissions. widely regarded as by far The Code spells out the obligation, but its The final Codemay not the most important in its statutory provisions inan&#13;
for overtime until they&#13;
idance must be taken satisfy everybody but it practical implications. an in- will nonetheless&#13;
joined TASS just over a&#13;
dustrial tribunal&#13;
rerceoc!onciled some widely differing interests and&#13;
How itcame about&#13;
easily understandable way.&#13;
Tt then provides examples year ago. Now they have&#13;
ofthe dutiesforwhich a wontherighttoanannual&#13;
union official should be lump sum payment of£285 for instance, more than 50&#13;
In fact we'll go a step further. We'll set ourselves another stiff target. We believe we can achieve a membership figure of 200,000 bythetimeofourannualconferencethisMay.&#13;
Ten times bigger&#13;
There are many grounds for optimism that an all-out effort can&#13;
achieve this intermediate objective. Year by year over the last si» years our membership has grown at an extraordinary pace. Our zare of growth in 1977 was ten times the rate we achieved before&#13;
WE NEED A BIG MEMBERSHIP in order to force the em- ployers’ federation to concede a national agreement which is eee inrespectofTASS's importanceanditsspanofmember- ship.&#13;
At the moment the employ cling hopefully to a picture of a small craft-based union which was long ago overtaken by events. Britain's employers are notoriously conservative (with a small “c”’ of course!) but even they will have to bring themselves face to face with reality. A union with a quarter of a million members is a force to be reckoned with. And a union with 200,000 members is a big step in that direction.&#13;
Wesellai!leadingbrands.&#13;
|uswhat you want and we }quote our own fow price&#13;
{&#13;
"BEDLINEN-STAINLESS STEL TABLEWARE&#13;
collar engineering staff than any other union and itsrate of&#13;
Ww creditand after sales service, to. Just’phone&#13;
The Code prescribes the conditions which coul&#13;
“ writeofcalllin. 7 LONDON: 3Hon&#13;
union is not an end in itself. Tt is the stren; th of organisation which a big membership represents, carbine with the vigorous olicies which are the hallmark of our union, that is fundamental&#13;
orevery TASS member.&#13;
strengththeycanrely.&#13;
So let’s get on with it. Let’s make good use of the impetus we&#13;
argued the case for tending time off faciliti and the Conservative Government's 1972&#13;
to effectively perform his union duties.&#13;
CR Wedd Rings,Sqnetfingr,Bracelet CharmsChainsandafGeldSrwedery&#13;
wre Mod&#13;
an ceePeon 1915)GearStret.Newcastle&#13;
1BRANYT CU a ay Cue&#13;
unions.&#13;
Not the numbers game&#13;
influencing the policies of the Government. Our delegates to the Labour Party and the TUC will have more muscle. Our General Secretary, Ken Gill, will have more power behind his position on the General Council of the TUC.&#13;
of Practice also gave alleviate dificulties. It general support. The draws attention to the particular significance of special problems of the the provisions in the EP small firm and to safety ActandtheTiOmffeCode andtheproduction is not that they move in a problems in continuous&#13;
It is important to get our campaign for increased membership&#13;
into focus. We're not just playing the numbers game; being a big knowledge that behind them is a massive organisation onwhose&#13;
‘oces plants. An oficial leet 1119ChestermanSt,(ofSouthamptonSt.)Reading necessary, to all the TheCodepointsoutthat&#13;
already have as the fastest-growing union in engineering.&#13;
It’s in your hands. You can achieve that target of 200,000 members by May 1978. The union is yours. Build it with con- pullout effectively asyou can inpersuading non-members to}ina&#13;
JAM:982TyburnRoad, PypeHayes.(21-3734602and021-3827101&#13;
radical direction but that&#13;
they provide statutory&#13;
support for extending&#13;
practices, which are now&#13;
publicly accepted as whenherequirestimeof.&#13;
KENT:31PickfordLane,Bexleyheath01-3033787/8465,&#13;
7BAlienPuce,&#13;
NeenwemtHeadese 13$3chadSad&#13;
fidenceandtakeheartinseeingitgrow.Usethisfour-page as&#13;
healthy and thriving organisation.&#13;
598203. ALSO:2coihartTeco&#13;
companies’)whereunions management ma ised. reasonably wish the time off to be postponed for a Isobeensupportedfor while,forreasonsofsafety many years by agreements or production, but says andhasbenacceptedbythatpartiesshouldtryto&#13;
CAYSTAL&#13;
Code of Practice 3&#13;
Patanest&#13;
PrctecActo$0n75, sen 8)(9)toeoreenby&#13;
ittedpaidtimeof.inlieuofovertime.InthepercentofTASS'sclerical jemaintains that sameperiod,thelumpsum members have een&#13;
Trade unions have for training of a trade union paid toengineers increased upgraded, gaining in- many years negotiated official should be permitted creases of up to £8 a week, facilities and time of as soon as possible after Supervisors also now back-dated to Septem!&#13;
election and that further receiveupto£400ayear, 1977, training should be un-&#13;
dertaken where a steward&#13;
has special responsibilities&#13;
or where circumstances change. F are given of facilities which management ‘shoul:&#13;
StilltheleadHaettornGsaridenfor&#13;
TOANYMAINLANDADRES themainemployers’reachagreementonsuchcaDRnemonnao organisations and by postponement,&#13;
Anannouncementtoall journalreaders!&#13;
No matter what others may claim, TASS organises more white&#13;
WE NEED ABIG MEMBERSHIP togiveusastrongervoicein Orderingiseasy—justtel provtoiednaebleasteward growthisnowmorethanthesumofgrowthofallothercompetitorshapingthepoliciesofBritain'stradeunionmovementandin&#13;
And most important of all, all TASS members will have the&#13;
TASS Nows &amp; Journal January 1978&#13;
New rights on time off for union work&#13;
What isaCode&#13;
PeterD.Carr,DirectofotrheEnquiryBranchofACAS,explains.&#13;
the ACAS Draft ae of es the facilities enabled&#13;
Frage ‘Union Duties and cannot go further than the have developed from Actiwvasiatppiroevedsbystatute,norcanitun-&#13;
Parliament. It ow to.&#13;
WE NEED A BIG MEMBERSHIP so that every plant is strongly organised and every office committee can talk to the employer from a position of strength.&#13;
200,000 MEMBERS BY MAY 1978. YOU/WE CAN DOIT.&#13;
&#13;
:&#13;
Swas abl 1977 onto the statute confirm that thro out book. this new law&#13;
Page Six&#13;
Page Seven&#13;
Engineers,&#13;
clerks, shorthand typists,&#13;
WHICH DIVISIONS have been setting the pace in our steadyBD esstowardsthequarter-milliongoal?&#13;
their choice. Ata top Si&#13;
Jevel_ meeting the played Institution's’chief getthetPaitentsgActs&#13;
its own history had ver been a co!&#13;
clarifie and extends the of employee in&#13;
en members’ u: and their&#13;
ngineers among&#13;
ure prop&#13;
Kil, qualifica sibility and&#13;
e. It has&#13;
its&#13;
applies the standards of Chartered excellence to its other&#13;
sional Code of&#13;
ee&#13;
 InotherwordsTASSisTHEwhitecollarunjoninengin&#13;
Thfe leader is undoubtedly Division 15 in Birmingham which has grown by 4,915 since 1971, more than doubling its membership from 4,865 to 9,780. Five other Divisions have doubled their membership since the new boundaries were set six years ago. No. 22, based in Luton, grew by 4,325 and now stands at 8,277; No. 12 (West Midlands) added 3,753 new members |and now has 7,390.No. 9 (Leeds) added 3.661&#13;
W&#13;
to set up an&#13;
which&#13;
embers to join a tri union of&#13;
ublications service iS matched by any other&#13;
Committee is of very well highly&#13;
publis 10&#13;
produced by TASS engineers for&#13;
bringing its total to 7,167. No. 1 (Edinburgh) has grown by 3,317 to its present total of 5,603 and No. 6 (Middlesbrough) has grown by 2,076 to a total of 3,919. Liverpool and&#13;
The Salford-based Division 10 which covers I&#13;
Manchester deserves a spe jal mention. Although it hasn't quite doubled its merembership since 1971, it has added as many as 4,662, bringing the total to 10,089. The Division held a special celebration in November to mark the enrolment of its 10,000th member.&#13;
The jobs of clerical workers are diverse and complex and many of them are&#13;
THE Salford division has just enrolled its 10,000th member. Present at the highly skilled. They are under-estimated celebration of this historic point were members of the other sections of our amalgamated union. Seen here with TASS General Secretary Ken Gill are John Tocher, Engineering Section organiser (right) and Wilf Charles, Construction&#13;
TASS really fights for women&#13;
MANY OF TASS's clerical members are women. They have joined because TASS has a reputation as an aggressive union in fighting for women’s rights.&#13;
Our slogan ‘Men’s Pay for Women’ has a serious intent. It goes much further than the more usual call because it recognises that too many jobs are low paid because they have traditionally been done by women,&#13;
TASS has a number of successful battles toitscreditinwhichithasbeenableto establish wages for women which would have been paid had men been doing the same jobs.&#13;
There is no conflict between men and women in our policy. It means better pay and conditions for all employees&#13;
spheresofactivity.To &lt;— TASS has always bring members the&#13;
included chartered&#13;
lest benefits of all the w employment slation, it provides&#13;
expert knowledge, re- rch cilities&#13;
TASS’s National Technical Sub-Committee is composed of highly qualified professional engineers. It produces a_ technical publications service which is unique.&#13;
(whe ssary) skilled&#13;
and articulate advocates&#13;
at tribunals and other developed a well-earned legalenquiries. reputation f&#13;
profound _chang to abandoned its original hich TASS has readil ly emphasis on education, pted. TASS has training, technical&#13;
e for TASS&#13;
Managers need a union. Too many&#13;
employers take advantage of their&#13;
loyalty and professional pride.&#13;
ay, working hours, holidays, nsions and ministrative staff are a low-paid group with ow your firm is organi’ ut all those&#13;
than 65&#13;
years TASS played tailored its organisation standards and the ad-&#13;
BY TRADITION, clerical and ad-&#13;
ue role in technical to the growth of large vance of professional education. Its technical industrial combines and codes of conduct.&#13;
other things which are so important: your work-load, the type of chair you sit in, the amount of space around your desk, the temperature of your office, the lighting, the quality of canteen food and of office coffee and tea. TASS believes all these matters are open to negotiation.&#13;
rocess, Many have skills which take as long to acquire and are no less important than those learnt in craft apprenticeships. Office staff need more pay, improved conditions, proper training and better prospects for promotion. And they need a&#13;
RECRUITMENT amongvantageoftheloyaltyand professional pride which makes&#13;
Of the 470,000 clerical and ad-&#13;
sophistication in collective bargaining Yet it has never&#13;
dustries and services, 270,000 are women. Women are joining the trade union movement at a truly remarkable rate. They provide the fastest growing sector of TASS membership — from 2,000 to 23,000 in the last five years. They realise that belonging realvoiceindecidinghowtheirwork toaunionistheonlyeffectivewayto ManagementstaffhaveapositiveTASShascreatedanational organised.TheonlywaytoachievethesecombatdiscriminationpoyBennie&#13;
haye come to realise yare missing out iftheir are not rep&#13;
some managers stand back from trade union membership.&#13;
strong trade&#13;
TASS; able to report the employees theyy supervise and establishment of new management provides forthem acommunications branches.Leicesteristhelatestone. intokthehighestleveloftheunion&#13;
is&#13;
goals is by organising and negotiating ual and opportunity. calls for&#13;
contribution to make to the in- management advisory committee dustries in which they work. They which will be able to relate directly need a powerful organisation to the Executive Committee. Its through which they can influence&#13;
through an effective TUC affiliated union. For staff in the Sneiae ae industries and services, that union is TASS.&#13;
office&#13;
Senta for ereny and leads the fight in the trade union movement for equality. Women are fast discovering that joining TASS brings real results: many hundreds of our female members have recently negotiated top rates of pay.&#13;
Managers need TAS: S.They need an organisation which gives them separate representation from the&#13;
inaugural meeting takes place this&#13;
month. TASS regards this as a very&#13;
significant step forward in ex:x New management branches are formed every&#13;
events. And they need a collective&#13;
voice to ensure that the size of their&#13;
contribution is reflected in the tending the rights and improving month. This is the latest Leicester's first TASS is committed to helping&#13;
wages and conditions they enjoy. the conditions of its management&#13;
Too many employers take ad- staffmembers. management branch.&#13;
TASS News &amp; Journal January 1978&#13;
and under-paid. Their work is vital.&#13;
Section organiser.&#13;
low status and poor prospects. This is largely due to poor organisation. Until recently most office workers have remained outside the trade union movement and so have had no means of gaining the rewards and recognition they deserve.&#13;
Bean angd, Maureeu,and +4pe cut my tax retums, nip out for wy wife's byrthday card, and ayrange&#13;
formaweeklybronzin Ionat&#13;
He. Young Apoll le Puysick!Miculture centre,&#13;
It is high time office staff had a better deal.Theirworkisvitaltotheproductionministrativestaffintheengineeringin-&#13;
of a million by 1980: we're on the way&#13;
ound the divisions:&#13;
the pace&#13;
setters&#13;
Quarter&#13;
Let’s make it200,000 by May&#13;
technologists, technicians, managers, computer staff, superviser; TASS covers them al,&#13;
eering.&#13;
staff improve sveryias ect oftheir working lives — not just the “big” issues such as&#13;
&#13;
 You don’t get much for your money these days — unless you join TASS. It costs you £1.50 per calendar month to belong to TASS. For that small sum you get:&#13;
Raat&#13;
TASS members.&#13;
Long-term unemployment benefit.&#13;
Your monthly publication, ““TASS News and Journal’.&#13;
And al the support and strength that you get from belonging to an effective TUC-affiliated union.&#13;
All for the price ofa roundof drinks.&#13;
~TaSSisarealbargain The best bargain&#13;
which it gave rise. It sets&#13;
out the basic facts of white&#13;
minority rule in a concise&#13;
and readable form. The attempts to reach a&#13;
regime's machinery of stitutionalsettlementwith MATERIALS technology politicalrepression,itsuse theregime. liesatthebasisofGe&#13;
Free legal aid if you suffer an accident connected with your employment.&#13;
Legal advice on your rights under the law. Freeconvalescentfacilities.&#13;
Technical publications prepared by senior technologist&#13;
—TheNewLaw’;by|altheActsofParliament nology‘whichithasmade&#13;
:&#13;
_ TASS News &amp; Journal January 1978&#13;
EhOOKS (2a&#13;
Page Nine&#13;
Rhodesia:Smithsment. There has been a r- small erosion of dif- ' ferentials for manual skills. !&#13;
ilegal regime&#13;
PEP say that these changes present the unions with a dilemma: “The&#13;
This, says, means that there has been | 4relativeimprovement for thelower pala.&#13;
majority to fight for basic&#13;
“Zimbabwe; the facts et detention without raisin of low pay has for&#13;
af har;r e and in- long major aim of timidation, political trials the policies of both unioo, ternational Defence and and illegal erections are and governments and has, Aid Fund for Southern described in depth, It to a modest extent, Newgate shows how asempts by resulted from the introduc- . London EC1; nationalist organisations tion of flat-rate elements 60p. mobilise the African into pay settlements. Thus&#13;
about hodo. published by the&#13;
human rights have been RECENT raids by consistently suppressed.&#13;
THE&#13;
the Smith regime into&#13;
Mozamabreienqtirueleyin IntermsoftheAnglo-&#13;
character with White American Settlement What should be the Rhodesia — a socie Proposals the regime's strategy for the future? which today is totally police, army, civil ser-&#13;
mobilised for war and has vice and judiciary would&#13;
always depended for its be retained virtually intact&#13;
survival on the guns of its during the transitional expanding economy wil it securityforces.Anewpub-period preceding inbepossibletoprotectthe lication from the Inter- dependence. Yet these are position of the lower paid national Defence and Aid the very institutions which and at the same time Fund for Southern ec have kept the White re ‘ovide adequate dif- “Zimbabwe The Facts minority in power and been rentials for skull, training About Rhodesia”, shows responsibleforenforcingaandresponsibility.Thisis&#13;
Sey EIN eBoy mass of racial laws and precisely what the trade&#13;
ighty-seven years ago teen union movement has ‘You mei&#13;
‘ou have forgetyour |sete Mimi?. -Gay Parie? ...Th&#13;
white settlers, financed by “Zimbabwe — TheFacts urging throughout the Liberation?” the British South Africa About Rhodes ludes current depressi&#13;
‘ompany,seizedeo)ofdetailedinformationontheEngineering Rhodesiathroughoy, strengthandcomposition&#13;
anddeceit,backedupbi oftheRhodesiansecurity:&#13;
sys&#13;
Economy thehistory of the The Proport liberation movement up to&#13;
the formation of the by Raymond A: Higgins) Patriotic Front and the publishor:&#13;
chronology of British Stoughton; ical ta: 96.&#13;
forces and the regime's&#13;
counterinsurgency — oper- materials_ About Rhodesia” traces ations. Further sections&#13;
the history of colonial cover ae franchise and domination’ and describes parliamentary system, the&#13;
_Occupational cpearsitng thiprtaycticeyeaarnsd ae pradaluced a stupefying liversity of materials availablet,o) the engineer:&#13;
pensions: the lawtransformed. sslectrieal pra and paver gation) into. the&#13;
ied totothesan eondctor “Occupational Pensions] The last section contains and the&#13;
“I'd like a word with you in my office, Bodkin!”&#13;
Jam Jackso that are relevant to occu-&#13;
blisher: The New ational pensions. ‘“Theproproepcetrties of metals goes&#13;
Commercial Publishing ‘ocial |Securit,re Pensions far beyond those required Company; prico£11. ‘Act 1975”, a for paccuceanees modern&#13;
tional Board metallurgy isacontinuii R. JACKSON has put Regulations”, Contracting quest tofind! the Tight&#13;
together a book that will Outs on ot material for use in projects&#13;
help all active trade Employments, | Equa unionistsonquestionsto ee&#13;
do with occupational ne eimai and&#13;
pensions. The bok iswel Review Procedure. There&#13;
written and easy to under- are also relevant extracts&#13;
stand, particularly the from the Employment&#13;
explanation of the new Protection Act 1975, and Higgins has written a book&#13;
which covers the field State pension scheme. Trade Union and Labour about as widely as a book&#13;
Mr. Jackson outlines the Relations Act 1974. of this size can and in&#13;
new Pensions Law, and explains the machine andterminology.The&#13;
also contains a full ex- planation of the new State&#13;
can recommend this sufficient depth to provide booktoanytradeaoe thereaderwithagood who is interesteid im- |general understanding. proving his members? ‘The author says the book&#13;
ing against this read with profit by any on industrial tribunals, which makes itprohibitive. introduction to the sub-&#13;
rks’ redundant.”&#13;
msion scheme. It also was written for students of elps on the thorny Material Sciences at ad- talso discusses and ex- question of contracting in vanced technical college or contracting out of the level or first-year under- ain the roletrade unions avdy ihe scheme. ie ¢| graduates, but it can be&#13;
rovisions and what would e required to contract out.&#13;
ave to play in pension&#13;
arrangements. It touches ponelisithe price of £11 engineer who requires an&#13;
R.M. ject. The style is rather than mathematical(and) the text is illustrated by good relevant diagrams. The&#13;
book isapleasure to ue&#13;
dismissal of employees, andholdingcompanies.&#13;
Winners and&#13;
losersonpay Computing&#13;
“Winners and Losers: when incomes policies have&#13;
7, Proceedings of the IFIP Congress ‘7, Price 65, North-Holland|&#13;
This has been a period information Processing&#13;
‘ay&#13;
This book provides in Alison show that the eeroeeace 1,000 pages a com- ;published by of the overal pay.pal prehensive survey of the an\d_ Economic has not been si; itfeane in most topical developments planning:price £4, most ranges of earnings in computing. It includes rthe very highest key papers on Fault-&#13;
POLITICAL and Eco- where dif: Tolerant&#13;
pod Planning have ferentials have been penientics and conducted a detailed in- diminished, and women's ions of Program vestigationintothemove-pay,wheretherehasbeena Proving;andPerspectives mentsinpayinthe1970s. Sighit relative improve- and Networks.&#13;
Bee&#13;
Patterns in tho both by by Christopher conservative and Labour&#13;
Santosh&#13;
David "The reaults of the survey&#13;
government:&#13;
Pour sfaterestaa the&#13;
as varied as sonic air- craftandiiclonsreactors, The subject is complex&#13;
and the field is wide with many specialisations. Mr.&#13;
“I think Smedley’s getting a bit too uppitty!”&#13;
WHAT CAN £1.50&#13;
BUY&#13;
YOU?&#13;
Two gallons of petrol. Ten loaves of bread. Three packets of cigarettes. Five or six pints of beer.&#13;
- ~abesoeecnpahateregensDirect-access’to: professional full-time officials. Effective and appropriate advice.&#13;
&#13;
 ; |&#13;
ricity Boardandafter&#13;
theearlydays ea&#13;
pee:&#13;
. ;&#13;
DRAFTINGPERSONNELREQUIRED&#13;
Ve&#13;
GENERAL DETAILERS ATTRACTIVESALARIES&amp;CONDITIONSts&#13;
2 Manchest Whom youneed it bien ihe conversion|| ropes Labourarty june!aE eSaECY)ouey ‘Theschemewillbeofneed TEN esto iccDantonWinemeee&#13;
.&#13;
!&#13;
a —__———a u al 0 | |&#13;
1&#13;
e&#13;
¥&#13;
~&#13;
Page Ten&#13;
a [&#13;
i&#13;
Page Eleven&#13;
- 6&#13;
Preteraby,aplicantsticalshoEunlgdineoelrdingat,lahsavteanserveadO.N.C.reocrogenqiusievdalternaitden ae scansondpomnedDireseonen ots ‘perience&#13;
Tel.Rickmansworth76352 technical staff at Alfred On top of this&#13;
Heche Coventry. marabers Received theirin&#13;
i -&#13;
=a&#13;
.&#13;
stl&#13;
veenquire aetnapape&#13;
those&#13;
(&#13;
foc yaare) £5permonth,dependent dificultiesinattempting individual contract|||gGjent,aA2UE5Dshop steward.&#13;
ie&#13;
0&#13;
i leastminimum standardsofpayand WEREQUIRE t . conditionsarebeingoffered. SHIP? recommends IS&#13;
MECHANICAL&#13;
in&#13;
in yaissetTmoBoe&#13;
ns&#13;
|Sieeeptsnaeeee ata COCs&#13;
eee epsoei ES&#13;
cularDundeLebDiosturicrtf(eEa&#13;
Jw&#13;
hes&#13;
E&#13;
PEOPL Ee&#13;
man oe its&#13;
active mel&#13;
i DRAUGHTSMEN/WOMEN ines&#13;
x&#13;
ha uanoee&#13;
pee anERS, (Male/ ngenginers/designers,preferably&#13;
PLANNER ELECTRICAL INSPECTOR&#13;
TASSIs oferi another s.&#13;
isoffering yOeftfi ‘ervice to its members. Frank&#13;
says Joe Ashton, the Pubintheirlives.“Down tp he there, the NF don’t need&#13;
Draughtsmen /&#13;
ias&#13;
e al;l rni&#13;
sophisticatedarmamentequipment, miselaunchingsystemsand NavalGunMountings.&#13;
faloteeeestion Caries tahreieavBaiOlOa)bleOvfrerenefarsolm&#13;
\OJECTSLTD.,&#13;
pases ie SAUtwe/eAnRY18%iancdreas2e1s% TASbiScaseattheCentral&#13;
—&#13;
—&#13;
the Honea&#13;
. sae 5&#13;
Arudimentaryknowledgeofthepurchase,estimating and quali ae&#13;
ROYA&#13;
Warvoquieiate mobrtdssaniavels&#13;
were won We the level&#13;
ofsalaries plements paid under&#13;
but&#13;
alatewb flycorienscrateethexperienceneeualifcatons&#13;
:&#13;
¢&#13;
by pueteseereastMee linewiththoisnedusptrayinthe Pprincesaethiaavherdag.epayse|SPTASARSISKE.memetbeArCsTIOaNt,SStattaitce AR London Bwalsackb workingcraffto)r&#13;
BS es Se Sea&#13;
Dr .&#13;
D tsmen/Drau&#13;
swomen&#13;
foventry area. *&#13;
gite’s TASS ‘|Office Back ‘bay, of the GAC ton, has&#13;
Se&#13;
eaeOae&#13;
e&#13;
aug)&#13;
Je design and manufact&#13;
lowance is pea Xsshoud wat,givingflparticularincludingage,presentaan&#13;
ncaa&#13;
VickersShipbuildingGroupUmi,BarrowLAIEGng1in9)e~eringingWWorks, BakaasBanroucknForeee!Cumbia&#13;
eure Roplivantasnotkt uxketoh a a&#13;
in Thescones ny was&#13;
Upkar Abrol presented the iecrensaawas expected when he was for&#13;
payable, ai&#13;
cdraughts: and.foury&#13;
: 7 nae&#13;
alitieations orvsaliceatriosns:—pauOi.vNal.eCnt.sot(Mehcihg)h,e/A&amp;dvenGgiPnaretstIilo(g293)s,pEng.eninstc.e(CrE3)&#13;
ope He Eecae,att0ended weTrokintgheinWmeesmtbersLandonhe ar "thefaerhraed”toeeget|rightawayand&#13;
tal&#13;
olinengineering. Somepractical ie Suacie: i hsoil be2ovoverer211iysoaresof&#13;
Green, Deputy ice Mani *&#13;
“After several years it flowing BroGa modified cover. No min are&#13;
STOaT ATEEa a ae : pore Te elonae&#13;
breacinaclhpuBrhposperoducwtoldion international OFJ] PIanrethnetafilrstOlifnisctearn)cepleaseaplyinwritingto&#13;
TRACER&#13;
FROM ‘TIME totinethis&#13;
Reaoc roothinwgasa,noeIt aNJn’ lasrte Tmeopnotrht,edihne&#13;
" STUC,inthepovt-World|]&#13;
awiderangeofbothstandar macunanyusedinalmostevery&#13;
Forover25yearsWilie|}:72ree"tnreainingwillbegiven Ecrarad Rin Ayrasirance oduct&#13;
forStafApplicationFormto&#13;
oapply mmembersabout&#13;
PBERROSOOKNENEMLARIMNAENALGTED.R, HEATH ROAD,&#13;
abana ..0602/65221&#13;
M DRAUGHTSWOMEN&#13;
eee Efedwcansvacemewihcotpricei £T2r,0a00ep.a. jobsothats =&#13;
which his knowledge oes&#13;
exceptiona f any Bish FederalWelder @MachineCo.&#13;
Ltd.,&#13;
lneomprornising as,the in Parlian st e&#13;
for&#13;
PAST, ;ESIDENTTPaine their tirst||Busey, eek&#13;
IDLAN!&#13;
atin, 1e = theores memberreas Piorincecaurmnarkesra/wacehcehseneTGaiktaing theexamplo ofa disabled. If unable to&#13;
dthiadtitthoehiNgahtlioingalhtheFrfoanct&#13;
caFuant&#13;
“through these&#13;
fener tsfromul'uverith0) onwWikel (worked tania! INDUSTRIALSILENCING LIMITED&#13;
77&#13;
UDoccmber 197.Atahnids alfefauirs&#13;
Exchange aoa&#13;
whicl 3 acl surerstoour unionsince°&#13;
fanerai viends UK&#13;
0, AYenginerwiththeScotish BURGESS&#13;
wilshortlyhavevacanciefsor HT&#13;
ent of anacident or sickness, promia are waived ununtil&#13;
e WouldaeOreShireesteseWorke(nr c0ofntrolthePres,smash whobecomes anMP&#13;
isretireimntenretstherreteacined a&#13;
Amountof Monthly&#13;
ORME or ; Der9eceel paymie.nt e 0&#13;
cer stsatattions and energy&#13;
“FOR YEARS we&#13;
7&#13;
DRAUG SMEN/ Pranticeshipionv!edne(list_sep-peavasnoOemyeYtsesonea||WOMEN/DESIGNERS&#13;
/&#13;
mitteeacaeeesarhea les £292.04 £5.050 FFWytetaebreabrekgrlootieamee, fog.oesGeofnerbalalck pAemoinp.l”ebacOkf aroeviews, aCAcording&#13;
rie&#13;
sc~hkenowmneasthe 5 $32,549 $5.00&#13;
Siclosinetiie heslea BsHHsityopportunitytoleamthetechniquesof percaeedyie apenas&#13;
tpoblicy/sherseidbeeGetaniyaweaross £7.00 srhere|CablneUMinsstora!people,whobbjectedita|puyiPeupeacelite&#13;
Vickers Shipbuilding Group Limited&#13;
DickWeolt him'lASSwontseemthe receptions ro inhis&#13;
i&#13;
roe&#13;
‘ompam Shipbutcer&#13;
:&#13;
experience.Oneyeardrawingofficeexperience.&#13;
Deb isemusasbuasncreivpetion10 a&#13;
anual from} o tion staf fa IRE ee ona oe He was fee to the&#13;
a&#13;
—&#13;
TEL&#13;
ce)&#13;
35 workfora periodof the, “Guardian wepeteragerds thansixmonthsbecause&#13;
pypepaluaneraployl-ise "TASr.egulJarournalwarticlesereir sickayand&#13;
MANSIGNENGINEERINGareengDaesgiegdnoinlybotohf Se e"alec opeel WNoeise,Chonetrnol (altsncarsParalocouriioallirent ve seuenslismectary and&#13;
$7.50 dotheirpartypirehcuebsarbto thatalseemedtolivein the next venture.for&#13;
and Macaee &amp; tetheyoungpeople wi mentinthefieldofEnv‘uicrtuornamlentanldEnMgeincehaearnincga,l AHtiome ¢tiadtisctersiesSpecklor tuhpeteeAutomotive &amp;&#13;
ofered at, terms,whic! if wherenotMemobteairnablear.elseo-k 9&#13;
#80 th:e,‘tunwehandt'osfv,ieownersnextl”ok neovuteervisiutbeudrbiana:E Sthuey'dd ATAs:hton talenetnedtedMP MPJoeJoe £9.050 tosce&#13;
ste od a = whoheombe camein contact. criencelulding related Structural&#13;
ifneattGtetenTiny UScsteiscmsTthuinvredsat||mGoiondimucmovente!chnicdaulcotqounaiicisatmionecetdo.OwNinCe||fPoliloewi\nogcpue.rsmonenedeatowowraktinloaudrNweOTTiIeNGHAbMe&#13;
‘Asayouhetjohinedthe JOHNROWAN|| B2sicexperienceinfabricatead/structurmalaystelb-e workpreferredbutotherdisciplines&#13;
tGnhder’provciosnitotnasntofrtehvieiwBentTelealchyenaort:edHotwheatverth,eathgeaimembfietfrorswor n anoth ees&#13;
man r esi mins er&#13;
$&#13;
fCgre&#13;
DIES — CHECKING FIXTURE ae Abplieations) indicating minimum salary MSAPTEECIRAILALPSURHPOASNEDLMIANCGHIDNREAUGHTSMEN.&#13;
theamountoflifecoverThisautomaticstepingfixedtermcovertobe erionded ey fren ge ount,of aia athetaken outandiconverted&#13;
ROL GOLNGENASSENELTTOO&#13;
JIG&amp;TOOL reqaundicronvenident:datefor:snterview,&#13;
DESIGNERS&#13;
Full”dteImlted the doublesinninevenrs:” Soracatet forme! | |Tass&#13;
seh tbceWhenyoureadie syutioonorion||Rosebatnnchorea&#13;
A&#13;
SeaeySeeeTe ShaftesburyAvenue,&#13;
Apply to: = MAN:&#13;
examination.&#13;
11Grades —‘TopSalaries_—&#13;
eae = Peedi interest. to LaeitEplicationformsmeried_couples.|,\¥hEDYouareceive&amp;©|P|soughtCeUaethitnthoebnexatsaelecLtiaobno.ur&#13;
J.F.HOLLAND, LTD. 46-52 Church Road, London, SW13&#13;
eae&#13;
ENGINEERING EN&#13;
TyneenWeen,&#13;
Tel: South Shields566721.&#13;
ELIE Soca ROLLESTON DRIVE, ARNOLD, NOTTINGHAM. Tel.&#13;
ter ofayoun should ae Ye|_| here bedisastrou fr eatpe Ernie, pictured&#13;
01-7480794/5&#13;
How itworks parentcan wu pierly wore ae&#13;
Me. A. Jones,&#13;
Burgess Industrial Silencing Limited,&#13;
preee&#13;
which is at present held&#13;
STs lls nS Discrimination&#13;
rmofnine years, willin special a ca apolGuTCRSLreSoniterextremFane PereO&#13;
3&#13;
is unlawful&#13;
ENGIN DRAUGHT.&#13;
tpan the amount the to pay the mortgage, betwoen Guardian&#13;
individual “wishes to bring upyoung chien HoyaliExchange’and the’| [leaestered coAtA five&#13;
=&#13;
|&#13;
Employers who adver} tiseJobs for“Draught fen"of“Engineersare&#13;
EERING SMEN/&#13;
assurance protection is |f lence ane required, These premia living. Tagusceiavavedeinnin:with =&#13;
, ret,Man- chesterMSSHN.&#13;
nsworth,Herts. Ce centwerewonbya ge eineaa TASS a&#13;
1 a 1c&#13;
STEELWORK&#13;
TASS eensoe for blic&#13;
.&#13;
foes oCanetined union in the motor | ational conference&#13;
é Wieond(tice|cecrondkaren)&#13;
|&#13;
DRAUGH&#13;
have Southetn hoopleany biatce s&#13;
5 vtehreyberleioaflthanteeditmaenodt.sisa e&#13;
in breach of the Sex&#13;
\dvertisements make anderson] Projects design and build plants for&#13;
gheeoetakelat|Members tiaicsthecompany.&#13;
Pan breakthrough for Divisional&#13;
caineected |&#13;
tad&#13;
menutidaAncdevertoinsingEmplo:$4 osfeplanatnidlojauyonruito,rlDowrsheaetus,gphiwpitnhgseaxmnpdereieqnruicpe- mentAdvertisingPractBlmentdetails.Dutiesarevaried&#13;
.&#13;
nd&#13;
fees Pons permanent&#13;
.&#13;
Jacanexcistiteors&#13;
oeaeeSSSenPoseee BEq|ezplaingincomedetail!Applicantsshouldphoneorwritegiving&#13;
asubstantialoay|inalhisunion,political WestLabourPartya See sees&#13;
e&#13;
1976. ordree his&#13;
|S esandSeservicecen-e|afagiatresledtheimtoejoienethe sea;soned wShoernecect tidewil&#13;
Chemic&#13;
a&#13;
al&#13;
evenbeeklats triesandnowrequireadditional&#13;
th&#13;
.&#13;
D&#13;
R&#13;
4&#13;
REQUIRED Life S&#13;
Alladsarecheckedtoseethatat WITHSHIPBUILDINGEXPERIENCE } urance . 2&#13;
a&#13;
IPandremaineda0|aay] ENGINE&amp;ELECTRICAL&#13;
sh u&#13;
a ||YOUNGENGINESRfeSm!ale) me 0 mem&#13;
. Quality Control Dept.) (For&#13;
assurance scheme which the ane&#13;
he La P. foc hasa rey DEaMdCESEen ike beeen naa&#13;
DESIGNERS TOOLINGDESIGNERS&#13;
es.andtonegotiate{heamount|ofcover It'sflexible pecnaseReeemployers Sa eae eeccen The flexibility ofthe&#13;
M&#13;
es&#13;
ech&#13;
an&#13;
ic&#13;
al&#13;
sANDEnson ay ging Director,&#13;
cin&#13;
ho&#13;
ht&#13;
Saunton Tupentifecture,high!performancemilitarysmallarmsand&#13;
STapmneat pderoadwingdoefsficgens/,detdarialuignhgtinorgPjige,RtOooNl,ATfixtUureNanTdOgpaeuxgpetidoenscisgnuinsedeithfeor&#13;
Double, issuley,sis Froi A es yofevents,&#13;
were ditshmeirssceoldleagues | the furniture makers November&#13;
e ne} .&#13;
high volume production mainly by a&#13;
ining wil be given ya semi-skilled work force. Some&#13;
wentintoAfatcetri.ononseviereael matakitnhagtrtlidmerstowereinbvuasdye ye bebalf. Eu:&#13;
¢&#13;
2he&#13;
ctical vest Einhoutaormetentaatcr&#13;
many saltAareome|tbeyayreedtolacksparse ExecutiveCommittee However, Dick makes it friends,bel beback in&#13;
CLIFF&#13;
5AO, post fre,&#13;
TiedUte:|onepion. Saneofeats 1944 but only attended&#13;
LEAVALLEY763333 EXT.224&#13;
(Finchley) pain Arenege plasinstall&#13;
p&#13;
die&#13;
ic&#13;
an Repeorbes emew life&#13;
oti&#13;
it,18potmedicalevidence,an Availabililtifye ofadsesautrhbaence: ®M{imiYee" pw in ane even those withiabealtt&#13;
two 5e0yearswilnotnormally Raearoce theouch, eanie, weTequire supportin&#13;
pfieter socrton: TASS is here to sive oir lable below average&#13;
i came back with Government whip&#13;
which webelieve| Year AESD,whichw&#13;
Zutobionraphical. ie&#13;
LTD. pacehinst&#13;
NOTTINGHAM269216. aecaverplanisforinadequateandaSeeaeen eee:&#13;
A&#13;
U&#13;
G&#13;
H&#13;
T&#13;
ING&#13;
S&#13;
W&#13;
O&#13;
ME&#13;
N&#13;
life and aintain member and continue for rensferrete ‘spendandhowmuch a eect ofaslongasrequired.TASS||TASS"represerbena&#13;
igible forta,relief&#13;
Members n d dividual contracts&#13;
) |SoncuitearoSine&#13;
|Scastemnceties eee fieiveersyGoa tC mstheScottia Opportunities andinvolveparticipationfromcoastmare mem erswin the:pabeadieolticensastaltaSgoEandehiseworkheasbeeeeEnentetiieDasieeeresee&#13;
t&#13;
LSMALL ARMS FACTORY ENFIELDLOCK,MIDDLESEXEN36JL&#13;
S&#13;
comenssioniog 1 endeeeal|rsa!ndtereela,euetntgsand 2percent&#13;
a terest&#13;
e&#13;
= esResolutiotonritebring,Scaonsolidating,ak’sSup: in&#13;
increasesunofder10tphercFeanit aNonvneumabler inofcr10e&#13;
~&#13;
-&#13;
ppzinearing Switching, Wolverh: Dick Woolf&#13;
|trade SMT is a leading | delegatein&#13;
eceived&#13;
obs back s&#13;
cr&#13;
e est}&#13;
won Wolverhiami | (etieal Die Ger dedded ita movethe design office out of fechairmaawardandtheannualpay|©twomembers. afDict1k5eyfeirarsrts’joisneerdvicTe.ASSTarifaHemeedtontta)&#13;
LABOUR&#13;
Mtapolitical in havewilyour Reinewil G0:&#13;
misesue.JanuaryFebruary&#13;
"in| man oe"Harris Lebuwsh,o reeDlieccktedsertvoetdheonEC.the EC&#13;
Ballards 2PD.&#13;
This represents an im: stwo ne ae major,&#13;
part Jemployers (by then he&#13;
Lane,|RavedecidtoejdoinTASS.SsBeythe iteone&#13;
completedtheround‘offorthemovement.&#13;
whenfive TEAEue&#13;
Ha&#13;
Chi — a timely| organise only last July. in 1941&#13;
MONTHLY|Christmaspresent&#13;
veeks, reinstatement was | German-occupied&#13;
the a&#13;
cot &lt; popular feature. coreperony abou fon bale just written a nov pnsopioyes jeohelens ‘Grass Roots”, about a&#13;
"enchtsiti corei sips,Pay inoBntainandspar received, to the&#13;
e formanyyearsaleaderinwithconfidencetothe memberin&#13;
e&#13;
g&#13;
and community work andwas He&#13;
t&#13;
: by|pfearaerinc19e4a3 can tsheorsvediawoholowyaolrlyk.edandwit1h0 ee action.&#13;
“&#13;
yeat&#13;
c&#13;
M ‘and W&#13;
, is looking forward can get anoth TEAS&#13;
in same without Dick. honour&#13;
meeting before his clear that when he's harness working unpaid&#13;
s&#13;
N&#13;
e&#13;
n&#13;
e&#13;
c&#13;
a&#13;
&#13;
|&#13;
the 1978 consus TASS carried out at she coy Asthe General Secretary | j,hound tocontinue. Itis longer hours of overtime computerised system General Secretary Ken Gill the third week in Januar) cints out: “We have the vital that TASS is and round-the-clock being introduced.&#13;
said: “It is in the interest and TASS Correspanene Post sophisticated salary | Trepared to cope with shifts @ Ensure that the&#13;
Pe :&#13;
Si Ny be ns&#13;
Oxford,from16thtoSond Considerationwillbe Thereareawaysmore andmadeafatpofit== July. Forty places are given to any loss of pay or 4pplications than places&#13;
; he TASS salary , their investment worth- ”mistorscalcontinuityofthereecetémoreaeesCRaatErwhilaeThalcancloaditorfillestconaultetiona&#13;
—&#13;
‘&#13;
jared&#13;
very important Central . ArbitrationCommittee tribunal&#13;
given of the way the iser, Len Formby, told the&#13;
&lt;&#13;
replace the traditional&#13;
mode of work of our&#13;
technician members and&#13;
substantially reduce the&#13;
demand for skilled designmaybeintroduced are stro!&#13;
" Discussing the plans for The census will CO aa 7 ded design. This trend attempts to introduce in advance of any&#13;
of every "member to Members. W to every census available to any | these situations, jobs of al existin complete the census form census forms toSCY trade union. It is crucial When the system is Better: not worse _ personnel are protecte: andreturnittoHeadoe ProrkpiaosWellthatourmembersmake beingsetupitcan andthatanynewjobs OfficesThisrie)essential-inike“300000.individual thebestpossibleuseofthis generatemoreworkand Technologicaladvance, risingoutofCADare informationinordertoover2000|t0ne0 by.ensuringthatthe|createtheneedforextraincludingCAD,shouldBivsteaffnaltreadoyon Emeror’ Ee ae ap hota indicates that maximum pombe pct staff, pee Boh fy improve the lives of tbe Payroll, with Special conditions of al o! oS ac loted ‘orms stalled it greatly speeds ror! raining where necess-&#13;
Rute&#13;
motors, time and a quart crials and weekday overtim&#13;
te&#13;
BOB&#13;
ee Tea {2informationcovers age,comPyedtoHeadOlfice.1|uptheprocesofdesign Jadteshorterhours SFY. 2 eetonHeadlengthoftheworkingweekurgeallCMsandmembersandproducedanswerstomoreleisuretime,moreTMInsistonsub-&#13;
nee HSER 14th an “whether ornot the toacalsae a problemssewicspool Sanitontablay working ae increasesaay, S ~ nm concerned is a_ possible F seldom hav: conditionsand more pay al employees whose&#13;
andnaenson-meCmbeSrs Ear P5atna This informartAiSoSn tyoear'simpcreonsvues pwute el u whensly desuipgonn coneunmiaten ItSeesrhoueltd n=ot lead to work is affected by~ the&#13;
in" establishmentswilbeprocesseadtTAS COnditionsthisinformation|Faculties. heavierworkloads, Tewsxstem. 5 PaAEooeereturnedandthedetailedisessential itali shiftsystems,andshorterworkingweek,&#13;
the ish eo ;— results will be sent to al&#13;
peaiBE areasoftheunionasanaid HAVEYOU&#13;
Capitalinvestment jpounting unem- longer holidays, a&#13;
ee rte lar er and to prosecuting the fight to COMPLETED AND&#13;
Computer aided design&#13;
and computer controlled production processes&#13;
ployment reasonableworktempo and proper leisure&#13;
a palary raevey improve the salaries and RETURNED YOUR olaced by any trade conditions of members. CENSUS MATERIAL? a in Western Europe In the conditions of free iFNOT, DOSOAS&#13;
and is a more detailed collective bargaining it 15 | soON AS POSSIBLE. census of engineering staff essential that we have the&#13;
Guidelines WollurgenASs&#13;
periods, : Organise&#13;
Wages “fair” but - Overtimeupped&#13;
TASS'S NORTH LON- § DON women organised a highly successful disco last month, The No. 24 division&#13;
hada Ehcroge Ely enjoyable&#13;
time and made a handsome profit too.&#13;
Connie Bloomfield, DC Delegate from the Divi- sional Women’s Sub- Committee, is seen here presenting a cheque for £105raised atthediscoto Richard Thompson, No. 24 Divisional President, for the Divisional Develop-&#13;
mentFund.&#13;
Connie says: “Social&#13;
activities can do a lot to win new recruits. Other divisions might think about holding discos.”’&#13;
TepS 2peaTuas=mee ‘ } rd e Si ;&#13;
AWAGE CLAIM&#13;
areatpresent142 m 84 are ction workers and 58 f. The TASS claim&#13;
aear mn col&#13;
ac sasiPrac&#13;
and typists However’ t&#13;
were within the win an award fo:&#13;
nerallevelforthearea pay.Ourmembe Bob&#13;
aie joins&#13;
Dickinson,&#13;
3 getting only £1 an The company manufac The CAC increased&#13;
hon F&#13;
en rotection&#13;
its disciplinary procedures what lengths smb yexs and its own conditions of pall go to,Lossck peopt ia servic fancy words are us!&#13;
esumm r&#13;
,&#13;
available. All TASS bers are eligibl&#13;
y&#13;
forfeited holidays&#13;
Don't delay! The closing&#13;
date is Monday, 13th&#13;
\ computerised&#13;
design&#13;
with their own particular&#13;
management, a&#13;
March, 1978. Write now to Scholarships will cover the General Secretary, the cost of board and resii AUEW/TASS, Onslow 1 dence and travel in excess Wall, Little Green, Rich-&#13;
s time and a half&#13;
ntatives who countries a top-level Philips pl&#13;
;&#13;
ended| the functionosf the former&#13;
1&#13;
AC was set up in&#13;
2 eae unten the nin&#13;
companyhaddisregardedinterviewer,“Itisamazing&#13;
r Ps, cavenedadbyby thethe tchoensidmercetding. where they&#13;
what questions|IBnodaursdt,rialandArbhiatsration| TASS member Bill&#13;
Daonal&#13;
Harvester Co.had oother example of sick&#13;
John Tuchfeld&#13;
Europe}8droppedfrom|representativesofem-manager,Mr.R.B.Parke: ey 82 to 72 per cent of the| ployers and — represen-| had ordered Bill off the&#13;
total employed worldwide. | tatives of workers. premises with the advice&#13;
}&#13;
members to notify the&#13;
union as soon as they&#13;
hear that computer aided be offective if employees&#13;
hool|manualworkers.Sinceattheirworkplace.Weandanalcreanieed&#13;
=|hugecapitaloutlayisshallthenbeabletogivequicklyandaccuratelyto necessary to install a advice on how to deal any initiative by&#13;
eS mond,Surrey,TW91QN. =&#13;
: Bob Dickinson&#13;
eran&#13;
retired TASS Aésistant&#13;
thathewas“struckofthe awarded £5,420 compen: oll” Benson&#13;
recently&#13;
General Secretary, has| ps .&#13;
=&#13;
etin SecretaryofStatetothe WINS PehurtherevidencewasTASSDivisionalOrgan-&#13;
een appointed by theBill&#13;
lthas'takenoven decision&#13;
ee baffle us — repudiation of Finding that Inter. contract indeed, it’s just&#13;
future. The most pressing | provisions dealing with | heari which tribunal&#13;
makesact&#13;
issue under discussion was | trade lasted tw union recognition, daypat econ any clai na&#13;
contractiand domestic car-&#13;
the company’s long-term|the disclosure of in- he had ‘repudiated his o planning intentions, in| formation to unions for contract” by refusi ita view of its apparent shift| collective bargaining, and performalternative we k of employment from| the extension of terms and | The Tribunal rejected Europe to the US, Africa| conditions ofemployment. | this argument vate andtheFarEast.Inthe| ‘TheCACconsistsofa|evidencehadbeengiven lastsixyears,thenumber|Chairman,oneormore|thewaytheae of&#13;
It Noli: perfect goo&#13;
of Philips’ employees in| deputy ak Chairmen, | industrial relavions&#13;
prireturnCatherleatan ohare UK "&#13;
i-&#13;
EuropeanMetalworkers’shouldberaisedwhen|ditionallynewresontpeeaves) eee4 iiti&#13;
nes succeded Hargreaves ithaliIribanal Federation in Brussels on the Philips central | sibilities, under the Em- against inh ee&#13;
inanadesustry.E ae&#13;
a management meets | ployment Protection Act, arvester Comaitca:&#13;
4 ¢&#13;
) &gt; \.&#13;
¥ members of the E or hearing complaints and | Doncaster i Se Executive in the near | making awards under the At an industrial&#13;
AUplopal ey&#13;
a TASS News &amp; Journal January 1978&#13;
 Page Twelve&#13;
output in order to make should be followed are:—&#13;
This approach can only&#13;
4 ia gpeME&#13;
—Showroom and&#13;
fitting service in most areas.—Postal quotations&#13;
Filinthe census It'sinyour interest&#13;
design is not new. TASS has been e on its progress. We do not take a&#13;
(CAD: itshouldbe =)&#13;
used for a better&#13;
life&#13;
COMPUTER aided&#13;
ci sU vages than any other, maximum information keeping a watchful e&#13;
eee MyETASSIncludingthoserunbytheavailableoneee eaditeviewtomoderntrendsbuttherearesafeguards providesauniquesurveygovernmentAnytradesalariesStyourwhichTASSmembersshoulddemandfromemployers&#13;
ofthewagesandconuanionist,empleytjtionmnembers; ThisisPe|\ichingtointroduce&#13;
in vi " CAD. Harry Smith, National&#13;
eonsosseeeraaninewantinginformationontheticularlysportSE Organiser,outlinessomeofthem. \&#13;
since 1923 and is unique salaries and conditions of of the Phe vie OVER RECENT months system,&#13;
not only for the breadth of staff employed in the base 0! ber managements circumstances.&#13;
of job cccaggroupeWOnaTASS will want to maximise general guidelines The which&#13;
; ‘ y wil eater the num&#13;
information but for the engineering industry will wr egoriea we cover the sumbers have reported&#13;
idbe&#13;
</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="39">
            <name>Creator</name>
            <description>An entity primarily responsible for making the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2082">
                <text>TASS</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="48">
            <name>Source</name>
            <description>A related resource from which the described resource is derived</description>
            <elementTextContainer>
              <elementText elementTextId="2083">
                <text>John Allan</text>
              </elementText>
            </elementTextContainer>
          </element>
          <element elementId="40">
            <name>Date</name>
            <description>A point or period of time associated with an event in the lifecycle of the resource</description>
            <elementTextContainer>
              <elementText elementTextId="2084">
                <text>Jan 1978</text>
              </elementText>
            </elementTextContainer>
          </element>
        </elementContainer>
      </elementSet>
    </elementSetContainer>
  </item>
</itemContainer>
