28 10 310 https://nam.maydayrooms.org/files/original/32be27cbeefac3170e8236557890b9ec.pdf 747ff52bd736aee4527f19a51b03b852 Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Education Description An account of the resource Many NAM members were engaged in the field of architectural education, either as staff or students, and pursued new ideas for course content and pedagogy, reassessing existing course structures and priorities in conventional architectural training. The concern to focus on socially necessary buildings and to find new and meaningful ways of engaging with building users and the wider community- both central NAM themes - illuminated much of the discussion. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource The Month Subject The topic of the resource Comments on NAB/UGC Report (1 page) Description An account of the resource Professor Andy Macmillan, Home students could suffer as a Vice-President of the RIBA's Education and Professional Development Committee and result of NAB/UGC report Head of the Mackintosh School in Glasgow, told the Journal that many schools are IMPLEMENTATION of the tempted to accept large numTransbinary Architecture bers of overseas students who Group report could lead to a pay much higher tuition than situation where all overseas home students. students are allowed access to Part Il courses while only a Teachers lobby fraction of home students are allowed to continue towards a Macmillan continued: "My professional qualification. department can earn {100,000 That is the warning of Cho per annum by bringing in Padamsee, formerly head of Nigerian students on urban the Hull School and now design courses, and the univerdirector of an MSc course at sity pressures me to take them. the Bartlett School. If there's a quota to be placed on home students, there ARCUK letter should be one placed on over- seas students." In a letter to ARCUK Macmillan: overseas quota. "Teachers," says Macmil- Padamsee: real danger. Board of Architectural EducaIan, "are a lobby to protect tion Chairman Professor John Tarn, Padamsee results explains from thatthe present• done abroad a portfolio to the ARCUKof work and made will aware separately of the anomaly,consider their is a lobby jobs, just to protect like the qualityRIBA the anomaly the implications prior to a and numbers." The view of Admissions Committee for TAG report having confined or to the fuller discussion and decisions many teachers, he claims, is: itself to home students. The Part Il exemption RIBA Special Entry Commit- on implementation later in the "We don't care whether they total intake of home students to Part Il courses should be exemption tee for partial from Parts or completeI or Il or spring. only (students) want to get fill jobs our or places not, andwe reduced to a maximum of 700 Overseas quota get as much money as possiper annum by 1989, it says. In both. "It is a privilege not It is possible that some form ble." 1982-83, overseas students afforded hitherto considered to British students,unneces- of quota on overseas students Macmillan suggested: comprised 19.4 per cent of all sary, since they were free to will be enforced. At present, "Perhaps there should be a students passing Part I and institutions set their new category of membership, therefore eligible for entry to enter Part Il courses". individual in relation to the RIBAO, for overseas memPart Il. Padamsee argues that Professor John Tarn told the own policies do Part if the TAG recommendation Journal: "It is a loophole numbers of places offered to 2 bers, here where and Part they 3 might in their home were carried out, and the same which could be used. We could overseas students. But if im- and would not be number of overseas students be taking on a lot of overseas plementation of the TAG re- country, were eligible to enter Part Il, students on a purely commer- port is to achieve its twin of aimsthe allowed Alternatively,to practise Macmillanhere." they would then comprise 25 cial basis. The RIBA's view of increasing the quality its argues, "there might be an Act re tstration to home per cent of all students on would be that if this was a backit profession numbers, the while RIBA reducing itself may of Parliament to diploma courses. Padamsee door to qualification, then says: "Schools of architecture, must be stopped." be drawn into recommendihg Stu ents." in order to protect their re- NAB and the UGC will be a quota on overseas •students. source bases (in particular specialist and studio staff), and at the same time achieve a 10:1 staff-student ratio, would be tempted to make up student numbers by recruiting more overseas students. In some cases this could reach as high as 50 per cent of the diploma course." Overseas students The result would be that only some British students would proceed to Part Il and obtain a British qualification, while all overseas students would. In addition, an over- Rank Hovis McDougall HQ at Windsor by Edgington, Spink & Hyne, who recently celebrated their seas candidate is eligible to 129th anniversary. The development includes 60,000 sq ft of oflices and parking for 250 cars. RIBAJ March 1985 7 NORTH EAST LONDON POLYTECHNIC Faculty of Arts and Social Sciences Holbrook Centre School of Architecture Holbrook Road Head of School London El 5 3EA Nathan Silver MA(Cantab) BArch(Columbia) RIBA 01-590 7722 4 October 1985 Dear Councillor of ARCUK, In one respect it is hardly necessary for me to lobby you about architectural education, because of all the formally concerned professional bodies, ARCUK has already taken the most unequivocal and admirable stand. To paraphrase, this was that the Council, according to its enabling Act of Parliament, was concerned only with the standards that were met by registered architects, not with the numbers of registered architects. Splendid . I think ARCUK's progressive view will be remembered and respected a generation from now when far more architects are engaged in community architecture, building rehabilitation, interior design and (even) new buildings, than the Esher report had the perception to foresee. What ARCUK now needs to do is to make sure that all the new roles emerging for architects can be filled by architects, not by those who are unqualified, or who are half—trained, or who in desperation have been hired in from abroad. That was the mess the doctors of medicine got our nation into when their misguided attempt at manpower planning a generation ago finally bore fruit. As for my School 's own fate, I confidently expect that NELP 's effort to get off the current NAB/UGC Working Party's hit list will be short and sweet. We can amply prove our excellence, efficiency and worthiness, and comments are going forward through official channels in this respect. The one point I wish to make that is of direct concern to ARCUK is that the closing of ANY good school of architecture doesn't improve the balance, it worsens it. I hope you will see that further time spent by the Council leading to comment along these lines is very much part . of ARCUK's central concern about standards. My great compliments, and best wishes. Yours sincerely, Nathan Silver Head of School Creator An entity primarily responsible for making the resource RIBA Journal Source A related resource from which the described resource is derived John Allan Date A point or period of time associated with an event in the lifecycle of the resource March 1985 https://nam.maydayrooms.org/files/original/fb2f19d9cf982d109c050338ef6e827b.pdf d5d8664db0610a6de6f4663cb61f465f Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Professional Issues Description An account of the resource A cohort of NAM members became engaged with the professional registration body, standing as elected councillors on the Architects Registration Council and its various committees. Hitherto entirely dominated by the RIBA bloc, the Council began to yield to a new dynamic through NAM's involvement, enabling fresh perspectives on such issues as mandatory fee scales, greater lay representation on the body, ethically-based standards of professional conduct, etc. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource The President "Eric's Whistle-stop Tours" Subject The topic of the resource The President "Eric's Whistle-stop Tours" Description An account of the resource itects, who are anti the RIBA, who think the RIBA isn't doing things for them. I myself am a life-long critic of the RIBA. But the RIBA is not a separate entity. It exists as a body of architects; and its quality depends upon the quality of the architects who play their part in it. There are people who are concerned about architecture and some who are prepared to work with the Institute. No one gets paid for working in the RIBA. I don't. People don't realise this. Neither is it a glorious club. It is the worst damn club I've come across. There are some members who are content to pay their subscriptions and believe that the Institute represents them adequately. There are a few others who don't contribute in any way, they merely snipe. I feel they ought to leave the RIBA to get on with its work, and its members to get on with their beliefs and develop their confidence. The Institute is better off without them. The RIBA represents a very large percentage of architects in this country. It is a club in the sense that it constructs rules, such as the Code of Conduct. But above all it is a big institution and institutions are the life-blood and force of change and growth of ideas. You have only to read the original Charter of the RIBA, dated 1837, about its purpose for the benefit of the community, the embellishment and improvement of towns and cities. If members don't believe in that, they shouldn't join. The right place for debating diverging views is the RIBA which is, after all, a democratic body. The way to change its shortcomings is by asserting or reasserting new objectives. People have elected me — they must know my views, therefore I assume this represents a view of Council. This indicates change. That is why democracy is important because it allows change to happen in an organic and effective way. If you want to make change go faster, then you have got to get more involved. Perhaps right now is the time for change. There is the ecological challenge and there is the environmental challenge which is con- 16.00 Meeting with Architects in City Architect's Department GLOUCESTERSHIRE ARCHITECTURAL 18.00 Dolphin Hotel, Portsmouth for ASSOCIATION, THURSDAY, 20th meeting with local and Isle of NOVEMBER 1975 Wight members 19.00 Informal meeting with members 20.30 Return home. at Hotel de la Bere, Southam 20.30 Dinner BERKSHIRE, THURSDAY, 30th OCTOBER 1975 SCOTLAND, 25th-27th NOVEMBER 1975 10.00 Arrive at office of Berkshire TUESDAY, 26th Nov. Branch Chairman 10.10 Fly to Glasgow cerned with the quality of our built environment, a growing worry that we have to share. Speaking about the present being a time for change, the President said that this leads to a re-examination of what architecture really is. It was pointed out that in America architects are involved in about 80% of industrial buildings, and a much lower percentage in housing, and that the figures are almost exactly the reverse here. The RIBA work very hard to dent the commercial and industrial market because it is of enormous importance to everybody. It is only comparatively recently in Britain that architects and Council have taken any interest even in housing. Industry has been resistant to architects with notable exceptions. Industrialists are beginning to realise that architecture can have advertising prestige value and so on. But few of them have seen it in terms of actual, intrinsic, social benefit in terms of their working environment — the effectiveness of what they do — as well as the symbolic, monumental aspect. Computerised technology — not talking about design — means industrial production ; you can work effectively in small units. The distribution of power means an end to the need to concentrate in certain areas ; resources can be moved, industry can be located with communities. But this concept has made very little impact on real planning theory. Even when you bring industry into new towns, it is considered a nasty thing in a block, creating huge traffic problems in the smallest of towns. This could be eliminated and the thing entirely integrated. Re-examination is needed. Schumacher's idea of smallness is not just a sentimental thing — it is a practical thing. The factor of size is of enormous social importance. I was talking to a group of doctors about the mammoth hospitals that were being put up. They don't work. Psychologically, organisationally, economically, socially, they are bad places. Buildings must relate and identify with the community. All the good ideas relating to change come from architects. The fact that we have allowed our operational freedom to be constrained beyond the point where we cease to be effective, is deplorable. (This is not to say we are a law unto ourselves and that we have no controls). Ask any good architect whether he was hindered or helped to produce his last good building. We have to go through the labyrinth of a planning department. I believe it is necessary to find a level where we can share the overall concern. By creating objectives which have some kind of nobility, we will all be uplifted. It is like the business of a company with a good PR department. Even if what the company is selling is not particularly good, the PR man can create a marvellous impression, the public will believe it and the company will begin to believe it and act upon it. Architects need some very positive PR help to relate to ordinary people. We tend to play down the more mundane and serious background to our work. We must correct the balance. We must make people realise that we are concerned. If the RIBA and its members start revaluing and revalidating themselves, they will start to feel better. The public will begin to respect them — it is a cumulative thing — and we will get back the nerve to do things on our own. Creator An entity primarily responsible for making the resource RIBA Journal Source A related resource from which the described resource is derived JA Date A point or period of time associated with an event in the lifecycle of the resource Feb-76 https://nam.maydayrooms.org/files/original/49b4868bd4b54059c4b34aa701f2b119.pdf e4bdd86c327935e0e41d628f0ab18cdf Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Professional Issues Description An account of the resource A cohort of NAM members became engaged with the professional registration body, standing as elected councillors on the Architects Registration Council and its various committees. Hitherto entirely dominated by the RIBA bloc, the Council began to yield to a new dynamic through NAM's involvement, enabling fresh perspectives on such issues as mandatory fee scales, greater lay representation on the body, ethically-based standards of professional conduct, etc. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Practice Subject The topic of the resource Article by Ray Cecil on ARCUK's Standard of Conduct Description An account of the resource had a quiet chuckle this week when the annual report of ARCUK landed on my desk. You mav remember that a few years ago the great unwashed objected to ARCUK's slmsh adherence to the RIBA Code of Conduct and managed to obtain a new Standard of Conduct. Because it was deliberately written in the vaguest possible terms, the Standard can apparently be interpreted to mean just whatever anybody wants it to mean and in fact became a licence for those architects who do not belong to a professional institute to behave according to their own aberrant standards. It seems that ARCtJK's discipline committee has found itself at odds with the Council owing to what is termed •different perspectives' and has experienced difficulty in making charges of disgraceful conduqt stick. It is now proposing to rewrite the Appendix to the Standard and give better 'guidance' to the unattached on what constitutes 'disgraceful conduct', •and I can understand why this should be necessary. Still, it should not be a difficult task. How about attaching the RIBA Code? I am sure the Institute would not mind. Leaky umbrellas Do you have Professional Indemnity Cover? Of course you do — or at least you think you have. The trouble is that you will not really know until you have a claim and your insurers accept it. The mere fact that they have recorded a 'notification of circumstances' is no guarantee that if a claim actually arises they will not repudiate liability or even void your policy altogether. I wrote some while ago of the unfortunate case where an architect had eight years of previous policies voided because he had failed to notify a circumstance (which had not given rise to a claim) and was left without cover on a number of other matters which had been RIBAJOURNALAUC,UST1988 Practice Ray Cecil discusses ARCUK's Standard of Conduct, the advantages of RIBA insurance, site safety, and the dangers of the cult of personality. 'There is a real possibility that buildings will come to be judged not on their merits, but on the eminence of the name in the bottom right-hand corner.' two years, has so far an unblemished reputation in this respect. Furthermore, no insured member has yet to resort to the condition that allows the Institute to investigate and intercede in the event of a threatened repudiation. I am well aware of the criticism that the RIBA scheme is expensive, although investigation of individual complaints generally throws up some good reason for high premium quotes. But bad cover is probably worse than no cover at all. You would not buy an umbrella with holes in it and that is only to preserve the clothes you are wearing at the time. Your insurance covers everything you possess! Incidentally, another criticism of the RIBA scheme is that it is ceasing to issue free to all practitioners the publication Professional Liability. As I am involved, let me deal with that one. RIBAIR, the company set up and financed by the money arising from the RIBA scheme, exists to promote activities which will help to reduce the liability of architects generally. It is currently funding a whole range of activities which previously had to be funded from the derisory budget of the Practice Department. With the current cuts in expenditure necessitated by a severe attack of Hay fever at Portland Place that situation is likely to continue. But just remember that the money arises from the members of the RIBA Insurance scheme. Extras like Professional Liability and the advice booklets produced by RIBAIR are part of the benefits of the scheme. The information in them is generally available elsewhere, either in the Practice supplement (partly funded by RIBAIR), in these articles, or in books commercially available. And plans are now afoot to make the other RIBAIR publications available to non-members of the scheme, on subscription. However, the best answer, if 17 �James Stirling was 'by It's shortsighted to ignore protection Being sued for negligence brings the benefits of professional liability insurance into sharp focus. Suddenly, it becomes priceless. If you haven't got it, however, the consequences could be too dire to look upon. The chances of a claim against you are all too real. It doesn't take much—an error by a junior, a simple omission, an oversight caused by too tight a schedule— all may lead a client to sue. You need the expertise of Nelson Hurst & Marsh. As the leaders in professional indemnity insurances we know precisely what cover you need and we have unrivalled knowledge of the market So we know where to find the right cover at the most competitive price. Then. if the worst happens, our expert advice, assistance and protection go into action, through our Claims Handling Service and Client Services Division. Our support is there when you need it most. You can't avoid professional risk, but you can certainly minimise the consequences. For further information write or phone today. Professional Indemnity. More than ever a necessity: QAI-)Nelson Hurst & Marsh Ltd. 1 Seething Lanq London EC3N 4NH. Tel: 01-481 9090. 18 names that tell us nothing about the guiding lights or the actual building designers. 'Ihey prefer to view architecture as a collaborative effort and let their work speak for itself. A few months ago I wrote of the pressure that the RFAC was bringing on clients to commission one of the 'name' practices for important prowcts, and pointed out the dangers of that. The parallel is clear and there is a real possibility that buildings will come to be judged not on their merits. but on the eminence of the narne in the bottom right-hand corner. And that cannot be good for the practice of architecture, or for bringing through and encouraging new talent. The author writes thoj articlcs as an architect in practice. TIC does not hold himself out to be tin expert in law or insurancc. For advice on detailed or spec:fic matters readers are (Idt'isdfl to consult their own lawyers. Computerised Classicism We enjoyed Martin Pawley's sardonic comments (April. RIBA Joumal) on the impact of CAD on the typical architectural practice, but we would like to correct one statement on our National Gallery competition drawings: about 25 per cent of our submission consisted of CAD originals. Most noteworthy, perhaps. were the large-scale site plan and elevations of Trafalgar Square. These drawings were our first foray into CAD. For the first year, we used our system solely for design and presentation work. We found it particularly helpful in drawing the Classical orders. You need draw the Corinthian capital only once: then you can resize it and move it around wherever you want. About 50 per cent of our tender documents for the National Gallery, including all the elevations and plans, are CAD generated. The oppurtunity it gives to revise and update drawings quickly, co-ordinate other disciplines, and deal with complex geometries is invaluable. While CAD has not changed what we design, it allows us to refine and improve the design much further into the documentation process than was possible or practical in pre-CAD days. It gives us architects a very fast pencil. Steven IzenourofVenturi, Rauch and Scott Brown, Philadelphia, USA Royal Remarks Norman Tebbit's unsubtle attempt to silence the Prince of Wales reveals yet again the paranoia of this Government. I trust the Prince will not be intimidated. The message is now clear; the Church should restrict itself to the 'spiritual', Amnesty International to criticising RIBAJOURNALAUGUST 1988 .4 Letters The impact of CAD, Tebbit's comments on royal views, help for black students in South Africa, and the Welsh Access Committee. foreign governments, theCharles' remarks as Citizens' Advice Bureau should constructive, as do the more keep its thoughts to itself, andmature members of the the Royal family may wave from profession. Royal boxes and pose for press I am sorry to have strayed photographs.from the drawing board, Mr T. Prince Charles is said byGeorge Ferguson, Chairman of Tebbit to be virtually without aAcanthus, Bristol job and yet he has been more effective in alerting people to the South changes facing our environment African Debate and future than anyone. EvenI have read the report in your those architects who were firstNIarch 1988 edition of the insulted by his remarks aboutCouncil debate on South Africa. modern architecture nowI am in agreement with the appreciate the enormous benefit reported sentiments as of the increased public interestexpressed in the Council's in our art. We may not becondemnation, and would like to flattered, but broader andoffer some suggestions deeper debate can only improve regarding any proposed architectural design.assistance. Charles' concern for theI would be delighted to see environment, from the buildings some kind of help being around us to the ozone layerextended to black architectural above us, and the plight of thestudents in this country by the unemployed, is a natural andRIBA. There are already thoughtful concern that hasbursaries available for this nothing to do with party politics,purpose at our universities and but everything to do withtechikons and any addition to humanity and his desire not tothese funds would be most reign over a deeply damagedhelpful. kingdom within a seriouslyIncidentally, there is no bar threatened world. The Princessbased on race, colour or creed Royal is, no doubt, the next toto anyone wishing to study be ticked off for revealing herarchitecture in this country. The concern about the plight oflimiting factor at present is starving children.simply that other professions The fact that Tebbitare favoured by blacks in apparently sees these Royal preference to architecture. remarks as dangerousWe at the rockface really need opposition reveals a your help and encouragement. mindboggling level of insecurity Our own office is at present from a Government that has employing, encouraging and neutralised all effective political lending support to several opposition. A more mature students who have not had the Government would see Prince means, and yet wish to become architects. and it is our wish that they will be able achieve their goals. Finally, one how British architects react if architectural bodies South Africa were to debate possibility of supporting an training centre in a third country, considering that it was your Prime Minister who compared the ANC as being an organisation similar goals. J. W. H. Meiring, Cape Town Disabled Access The Access Committee Wales, a committee of the Wales Council for the Disabled, provides a national forum on access issues. Its membership includes representatives of disability organisations, councils, professional associations and the Wales councils for the deaf and provides guidance and advice on access matters to developers. We are currently monitoring the operation of Part M of the Building Regulations 'Access for Disabled People'. If any readers have experienced Part M could they details to the Access Wales Council for Caerbragdy Industrial Bedwas Road, Caerphilly, Mid Glamorgan CF8 3SL. Carol Thomas, Access Officer, Wales Council for the Disabled European Exchange I am looking for a British architect's family with daughters aged about 13 and 15 who would like to get in contact daughters. They are interested in having British pen friends and an exchange in 1989. We live near the Black Forest not far from Baden-Baden. RudolfJohannes Schott. Kåthe• Kollwitz-Strasse 14, 7505 Ettlingen 6 — Ettlingenueicr, West Gennany 19 Creator An entity primarily responsible for making the resource RIBAJ Source A related resource from which the described resource is derived JA Date A point or period of time associated with an event in the lifecycle of the resource 8.1988 https://nam.maydayrooms.org/files/original/3ff00e970159e7c40822b4c36e6ae7e7.pdf 44eb3716f3540650c6e1d2128557d446 Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Professional Issues Description An account of the resource A cohort of NAM members became engaged with the professional registration body, standing as elected councillors on the Architects Registration Council and its various committees. Hitherto entirely dominated by the RIBA bloc, the Council began to yield to a new dynamic through NAM's involvement, enabling fresh perspectives on such issues as mandatory fee scales, greater lay representation on the body, ethically-based standards of professional conduct, etc. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Letter to JA with notes of meeting of ARCUK Registrar with Unattached Reps Subject The topic of the resource Letter to JA with notes of meeting of ARCUK Registrar with Unattached Reps (10 pp. total) Description An account of the resource F.A.O. John Allen Avanti Architects Ltd. 39/41 North Road LONDON N7 9DP 24 June 1988 Dear John Enclosed are notes from the last Unattached meeting prior to the ARCUK Council meeting and our meeting with the Registrar — dust to keep you up—to—date with what was discussed. Maybe we can start circulating minutes regularly if people think it's useful. I've also enclosed an extra copy of Torn Markus' draft policy document. If you have any comments, you can telephone Tom (horne tel. 041-339 2829) or Alistair (work tel. 031-668 2635) before the end of June — although please remember that this Is not intended as a final joint statement, and individuals are of course at liberty to change the wording and emphasis as they think fit in their 'letter to the local electorate'. Hope the enclosures are of Interest! Sheelagh McManus cont.../ UNATTACHED MEETING WITH REGISTRAR: 14 June 1988 PRESENT : K .Forder ; N.Arn01d, A.B1am1re, A.Ear1, M,Jenks, M.Ke11y, T ,Markus, S ,McManus, D.Petherick, D.Roberts, C.Shaw; ITEMS DISCUSSED: . Contacting the Electorate: The possibility of organising a mallout to all the Unattached was discussed. A full address list (straightforward computer printout) of the Unattached can be bought from ARCUK for E30 — can be organlsed on a regional basis or grouped In accordance with year of registration — or ARCUK can supply printed address labels at 2 pence each. Postage is the most expensive part. It would cost E 1257 to commission ARCUK to carry out a nationwide mailing to all Unattached (6700 architects) or E533.50 to mall all the Unattached In the London area only (1890 architects) proportionally better value for money!. Both include a E250 handling charge. Micheal Baird (ARCUK Admissions secretary) said he would check whether it was permissable under the Data Protection Act to supply the address list on disk. . Research Into the make—up of the Electorate: Various methods of surveying the Electorate to establish who they are and what their views are were discussed. It was felt that this might link In with the previously mooted possibility of applying for an ARCUK Research award to document the history and development of the Unattached. The registrar confirmed that there was no regulation to prevent a currently serving council member applying for such an award. The deadline for this years applications is the end of July. 3. Definition of 'Maintaining a Register' The need for ARCUK to compile statistics about registered architects was discussed (In relation to the previous Item). The registrar did not think that this was necessarily ARCUKs job. The 1931 Act simply requires that ARCUK "shall maintain a register of Architects". However, he also quoted Halls Laws of England which states that a Statutory Body is entitled to do anything which It considers "relevent" to its alms. Information relating to architects other than their name, address and date of Registration cannot be held on disk at present because this would mean that ARCUK would have e to register under the Data Protection Act. (At present ARCUK Is exempt). cont.../ / 4. Gentlemans Agreement As far as anyone knew the sub—committee which was supposed to have been set up to review the Gent lemans Agreement had not yet met. There was some doubt as to whether It had even been constituted. Any changes must be notified by October If they are to affect next years elections. It was generally considered that it would be unconstitutional to abolish the agreement completely since It is the only means at present of complying with Regulation . Statistics for membership of Constituent Bodies At our request, the Registrar provided current statistics on the no.s Isited for each of the constituent bodies and the Unattached (see attached sheet). It was confirmed that 'double-counting' does take place i.e. architects who are members of more than one Constituent Body count towards the number of seats that both those Bodies have on Council. (Therefore the total no.s listed for all the Constituent Bodies plus the Unattached do not add up to the total no of Registered Architects!) . Misuse of the letter 'A' Several individual cases have teen brought to the Regis trans attention recently where acronyms containing the letter 'A' meaning 'Architect' or 'Architects' are being used for business purposes by persons not on the register In fact in some cases by individuals who have been removed from the register for disgraceful conduct. The most .commonly occurring misuse involves members of the R IBA. (see attached copy of correspondence between the Registrar and RIBA). It would appear that there might be anything up to 1000 RIBA members practislng as architects who are not on the register. ARCUK is therefore intending to carry out a 'line by line' check of all RIBA members to single out offending Individuals, starting end of June, to be finished In time for the October count. � Meeting of the Unattached held 14 June 1988 (subsequent to meeting the Registrar) PRESENT: N.Arnold, A.B1amire, A.Ear1, M.Jenks, M.Ke11y, T .Markus, S.McManus, D.Petherick, D.Roberts, C Shaw; IT WAS AGREED ACTION BY: 1 . To investigate the feasibility of setting up a Company Limited by Guarantee to service the needs of the Unattached, with the elected Unattached Representatives on Council as the Board of Directors. Possible benfits might be: Free mallshot; Grant support; etc. D .ROBERTS 2. To check out the Intricacies of the Data Protection Act — Its implications for ARCUK and the Unattached. (Liaise with Micheal Baird on ARCUK staff). C.SHAW To look at the possibilities of the Unattached maintaining a current database of names and addresses. C.SHAW 3 . •That we should plan for maxirnurn publicity around the time of Unattached nominations and elections. A draft Joint policy document for the Unattached was tabled by T.Markus. (Copy enclosed for those not present at the meeting). Everyone present was generally in agreement with the maln points. The idea of holding an open meeting of the Unattached in Hull in November to debate this policy was proposed. It was agreed to first conduct a publicity campaign by letter and in the press to sound out support for such a meeting. It was agreed to purchase an address list from ARCUK organised by regions (donations of E3 each were pooled) and then divide it roughly equally amongst us. Each representative will be responsible for contacting a / IT WAS ALSO AGREED 4. To make an application for a research award to document the history of the Unattached and survey their current views. Mary Is leaving her current Job soon and was Interested in carrying out such a research project. M.KELLY T .MARKUS M.JENKS ALL NAMED PARTIES TO REPORT BACK TO NEXT MEETING ON. . . Tuesday 11 October 1988 at 2 pm at 73 Hallam Street. �0 q020 0(いト℃ ニ 亠い)を」:」. Nコ -亠W.」.3 00 0~い っ一0)ナ」 -亠 工 ヱ辷 W. IA 1.9,T」:一ぐこ:9 ト一ぐ一ニ N「一辷 �� KJF/CK 6 April 1988 Peter Sutton Egq Royal Institute of Br1t1Bh ArchitectB 66 Portland Place London WI Dear Peter As you know you and I and George McClellan have recently digcugged the case of Blacker who wag Btruck off the Register In 1985 and hag not applied for reinetatement. George tellB me that he applied to regume memberghlp of the RIBA, I think the next year, and thiB wag granted. This meang that he now holde RIBA membership when hig name 1B not on the Register. Thig 1B not' the first cage we have met of thig Bort (another cage I have come acroBB recently 1B Alan Victor Wall 1B who left the Register in 1977 and hag been an RIBA member, apparently, ever since ) . I am rather concerned about the law In thig matter. A pergon not an architect In th1B country unlegg h1B name appears on the Register. The RIBA 1B an aggoclatlon of architects (not architecte and otherg ) . There are Indlcatlong that there may be other pergong in RIBA membership who fall In thig sort of category and we shall have to take Btepg to ensure they are not included in congtltuent body countg. I am told that another possible gource of discrepancy the categoriBation of people working overseas. The law requireg that the Regigter conglBtB of a 11Bt of buglneBB addreggeg and that only those businegg addresseg within the United Kingdom may be used eor congtltuent body counts . learn that there 1B a number of RIBA memberg in regpect of whom you may have recorded home addreggeg within the United Kingdom whereag In fact their buglneBB addreggeg are overgeag. We must ensure that these are excluded. The present plan 1B that we are going to comence In May an operation {'cr a 1 ine by llne examination of the RIBA 11st. It may take Beveral weekB. I thought I would let you know thig now because you will doubtleBB either want to be present yourself or Bend gomeone from your office while the operation 1B going on. Perhapg you could let me know dates In May and June particularly which may be cnnvenient for you. Yours Blncerely ReglBtrar Royal Institute of British Architects 66 Portland Place London WIN 4AD e 01-580 5533 PGS/NB 14th April 1988 K J Forder Esq Architects Registration Council of the United Kingdom, 73 Hal lam Street, London WIN 6EE Dear Kenneth, Thank you for your letter of 6th April 1988. The RIBA elects or reinstates people to membership in accordance with its Charter and Byelaws . There is no requirement that a person s name must be on the Register of Architects or indeed remain on the Register but at the last count in October, there were 5108 members vhose names do not appear on the Register. The only requirement to take account of removal from the Register is if a Council Member or Honorary Officer is struck off in consequence of a criminal offence or professional misconduct. All members are required on election to sign a Declaration that will be governed and bound by the RIBA Charter and Byelaws and clearly any member whose name was not on the Register of Architects and who styled himself Chartered Architect or used the RIBA affix in relation to any trade or business would be acting illegally and would be in breach of Charter clause 4.6 and I can assure you that the RIBA seeks to enforce the Registration Act in this respect. With regard to the constituent body count, as you know every effort is made to keep the records of both ARCUK and the RIBA . in line. RIBA members who are not on the Register of Architects are not included in the RIBA count and account is taken of the address on file but of course it would be completely incorrect to say that our addresses remain in line as we have no statutory requirement to use the business address . However, the number of members involved would hardly be significant. With regard to your line by line examination of the RIBA list, clearly we would like to know how this is going to be carried out as the greatest problem is finding an up to date list. We would also require to know what alteration you are making so that our own records can be amended. I will be on leave from 25th May until 20th June. Would any advantage be served if Chris Lakin and I were to meet you to discuss this . Yours sincerely , P G Sutton EMBERSHIP ADMINISTRATION SECRETARY Fax: 01-255 1541 Telex: 24224 MONREFG quoting ref 2931 DISCUSSION NOTE FOR UNATTACHED COUNCIL L CRS ' 1 4 . 4 . 88 i . Campaiqn strateqv Obtai n awareness by unattached arch i tects by next el ecti on . Good publ i ci ty. Campai gn document - draft ready for October. Circul ate to press etc . Second , i nt•ensive , campaign , January 1989. Possi bl e regi onal meeti ngs? In School s? Rel ati on to Hul l meeti ng i n November? Circul ati on of statement to al l 6600+ unattached. Ca . f needed f or st ati oner y , postage etc . ARCIJK can supply printed l abel s. How to rai se money? Coul d one approach al l unattached for an annual donation of €1 . 00? 2. Campai qn content . Pi ck on one or two key i ssues and pl ug forceful l y. Uni fying theme - Parl i ament cl earl y i ntended , i n 1930s , to bri ng to bear on practi ce and educati on i nf l uences wider than merel y those of professi on . Communi ty at l arge . Nowadays woul d be cal l ed bui l di ng users and bui l di ng producers (see representati on from vari ous educati onal , publ i c and trade/ craft bodi es) . Means wideni ng cr i t i que of bui l di ng qual i ty to i ncl ude the i nterest of these , often ' di senfranchi sed , groups. Therefore focus i n campaign on two central objecti ves. 2. 1 Educati on Ful l support to current ' i n i ti at i ves for 50/50 partnership wi th RIBA i n Vi si ti ng Board. But , i n l onger term, develop towards taki ng f ul l charge of statutory educati onal functi on. In both short and l onger terms, i n any case , develop cri t i que and cri teri a for educati on whi ch ari ses from uni fyi ng theme above. I . e. bri ng to bear on formation of archi tects continuous i nf l uences from community. Beyond occasi onal communi ty archi tecture ' project . Teaching of soci al practi ce and soci al theory , es central as technology , management and aesthetic content of courses. Real i ssues i n every project. Identifyi ng conf l icts of i nterest i n al l bri efs. Becoming ski l l ed i n si te and product i on processes. Shi ft i n CPD so not just techni cal / l egal / management/ computing etc. but re-ori entation of atti tudes to practi ce. Practi ce Br i ng bear bui l di ng performance . i n interpretati on of The Standard of Conduc t . Invol ve non-archi tectural interests in arri vi ng at deci si ons. Open processes to publ i c vi ew. But more than broadening di scipl i nary procedures , which are desi gned to be reacti ve 1 to fai lures . Encourage performance-based not i on of qual i ty (techni cal 5 soci al and aestheti c) trough qui ciance , CF L), medi a mater i al . Work wi th user groups. He seen to be acti vel y promoti ng Par l i ament ' s intenti on E agai nst restri ci tve monopoly; wi dening cri teri a of judgment of archi tects ' competence; bui l di ngs as evi dence . . Research possi bi l i ty , Nobody knows anythi ng about unattached other than names -s such as age distributi on , sex , geographi cal di str i buti on , type of employment , reason for bei ng unattached , att i tudes to practi ce , education etc. , how d id they become unattached - from start , l ef t const i tutent body f etc . Coul d be found out by proper l y constructed survey and anal ysi s. Apply for an ARCIJK research award t G do thi s? Who shoul d appl i cant be? TAM Gl asgow B. 6. 8B Creator An entity primarily responsible for making the resource S McManus Source A related resource from which the described resource is derived JA Date A point or period of time associated with an event in the lifecycle of the resource 24.6.88 https://nam.maydayrooms.org/files/original/da414e60427de80023f203c87961f9af.pdf c6d7df2d9500ca68216f05b9c8d56677 Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Trade Unions and Architecture Description An account of the resource Themes included action on asbestos and Health &amp; Safety, and involvement with Direct Labour Organisations and Building Unions. Following comparative research of possible options, NAM encouraged unionisation of building design staffs within the private sector, negotiating the establishment of a dedicated section within TASS. Though recruitment was modest the campaign identified many of the issues around terms of employment and industrial relations that underpin the processes of architectural production. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Newspaper of TASS BDS Subject The topic of the resource 4 sides A3 newspaper "Who pays it…Who gets it ?", et.al. Description An account of the resource Who The end of professionalism as we know it,or the first step back to reality? Variously described as a ‘bombshell’ and a ‘foregone conclusion’, the Monopolies Commission Report on Architects’ Services promises to be a major topic of debate among the architectural profession during 1978. Because it opens the entire Pandor's Box of fees, profits, salaries and quality of service and the relationship—if any—among them, it is as worthy of attention by architectural staff as by the partners who were the prime object of the enquiry. In fact salaried staff haveacriticalroletoplayinshapinganew system of architects’ fees. The Story So Far In case there are any readers still unfamiliar with the main gist of the Monopolies Commission Report, ict us begin with a brief outline of the events leading up to the present situation. The Monopolies Commission Report, ‘Architects’ Services—A Report on the Supply of Architects” Services with Reference to Scale Fees’, was published by HMSO on 9 November 1977 after four years of investigation carried out at the instigation of the Department of Trade and Industry, was not the first time the |Government examined theprefessiononthis if .beiasdfo Asjongdebenpcosage the Natinna! Board pays Who gets it? employer-dominated RIBA is already trying to Propagate the fallacy that dropping the man- datory scale will lead, through “fee cutting’, to reduced salaries for staff and increasing likelihood of redundancies in times of depression. This last ditch attempt to save the present high profit, low-salary system relies onpresenting the picture of a homogenous profession united against changes that ‘will entail a lowering of standards’. Anyone stil holding a lingering belief in these argurnents should ponder how successful the existing fee scale system has been in distributing profits, equalising salaries with other professions, preventing redundancies and main- taining “Standards’—in the light of, respectively, the above quoted figues the unprecedented numbers of architectural workers currently unemployed and the almost ambiguous public disenchantement with our profession. Alas, the mandatory minimum fees scale may be capable of procuring healthy profits for partners in private practice, but it is less successful at performing these more important functions. Rather than rushing to the defence of their employers’ fee scale, salaried staff would do better to organise in TASS in order to exercise effectively their combined strength and secure equitable salaries and conditions. At the same time organisation will allow them to begin, together with other organised workers in the construction industry, to bring to bear on the Prisca rand laconseaensuitvecorir’ nded that tm mandatory fee scales should be dropped. Although several amendments to the scales followed that report, the RIBA contested its principal proposal and, bya mixture of obstinacy What else should salaried staff do? 1, The Commission has opened the door to a major rethink in the way archictects are paid. Salaried staff can press fora new fee system based on the cost of architectural seryices rather than the capital costs of construction. 2. Implementation of the Monopolies Com- mission's findings will entail major surgery to the Codes of Professional Conduct. Salaried architects can play an integral part in reforming the Codes by exerting their influence through TASS, their ARCUK representatives and the technical press. and stealth, succeeded in retaining the mandatory status of the fee scale. By assigning the present investigatiootnhe Monopolies Commissiont,he Government in effect made the mandatory element of architects’ fees the prime target. The Commission's conclusion that the monopoly operates to the detriment of the public interest has made the abolition of the RIBA—sponsored ‘price ring’ (the scale of Fees) a virtual certaintly Few peoplestill expect that the RIBA Conditions of Engagement and the RIBA and ARCUK Codes of Professional Conduct will last out the year in their present forms The main feature characterising the system of architects’ fees in the UK is that here fees are union organisation Nor surprisingltyh,e Monopolies Commission Issue 1 May 1978 The Commission's Report has now passed to based almost exclusively on a percentage of the Director of Fair Trading who must report to contruction costs. This distinguishes it from the the Minister by May on his progress in dis- systems of virtually every other country covered cussionswiththeRIBAandARCUK astohow bytheEnquiry,(seeReport,Appendisx6,p156), their rules will be changed to give effect to the in which some serious attempt is made to relate Commission'srecommendatsions,aswellason feestothedegreeofcomplexityofthebuilding siblity occupationswithoutmandatoryfee forsttaodfisfcussopenlyamongthemselvestheir hisprogressinpreparingforanindependent project.Thedifferiesnsicmpelebutimportant.In agency to determine a new system of voluntary the UK fees are based on the clients’ building fee scales. If the Minister considers that the RIBA costs, whereas elsewhere fees relate more closely and the RIBA dominated ARCUK are dragging to the actual cost of providing the architecutral their feet in these matters, he will make an Order service. Architectural design being labour rather ofParliamentrequiringthenecessarychanges, thancapitalintensive,coarsectompsrisedalmost in1973,thelastyearforwhichfigueswere overheadsandprofitsaswell. which if unchallenged in the Commons acquires entirely of staff salaries and overheads. theforceoflawafter40days.Inshort,the TheRIBAfeescaledivtoherdetcermeinastionof available to the Commission. Hands up all 4. Lastly, the Monopolies Commission requires salariedstaffcarningevenhalfthatamountfor thesettingupofaspecialagencytodevise Government issaying to the RIBA ‘Jumpnow, or we'll push you" Eight Tenths of the Iceberg practice income from the cost of providing the service, thereby reducing the leverage staff may exert in influencing their own salary levels. We are all familiar with the large practices doing large projects who minimize design input and max- those years Of even greater significans the Commission's proposals for a new fee system, but deliberately left its composition and terms of reference vague so that they could be the subject of recommen- dations by all interested parties. If architectural workers will take the initiative and debate the Readers are probably aware that since the imise partners’ profits, since they can't be Commission's investigation was into fees—as ‘undercut.’ Without a minimum fee scale, they distinctfromsalaries—itsattenwatsfiocousnsed mighthavetoprovideaqualityofserviceto primarily on the activities of principals in private survey further showed that principals’ profits increase dramatically with the size of practice Figures for 1973 show average profit per principal rising from £6,469 in partnerships with 1-5 direction the agency should go, they have only to technical staff (including partners) to £61,394 in present their case to the Directorof Fair Trading. partnershipswithover50!(Andprofitsofsome practice, hardly 10 per cent of the architectural profession and their clients. These are the parties, who respectively charge and pay mandatory to high profits but ithas had littlebeneficial effect minimum fees. These parties however, represent on the salaries of the architectural staff who only the tips of two very large icebergs, namely actually get the job done and earn those profits the building design staffs, 90 per cent of the Salaries, not surprisingly, bear little relation to a profession who provide the bulk of architects’ practice's fee income under the present system services;andthecommunity,whoasusersof Whenfee’sgoup,it’sthepartners’profitsthat buildings form the groups whom the clients rise, not salaries. ‘Tepresent’. Although neither receive much Salaried staff must face the fact that their coverage in the Commission’s Report it is standard of living depends on two factors far less ceriainly none too soon to speculate how both will be affected by its recommendations though in the case of this article we concentrate on the former. UK on its own esoteric than the mandatory status of their bosses” fee scale: 1. the demand for architectural staff, which is of course a function of ‘work load’ in the industry, rather than fee income, and 2 the degree to which architectural staff exercise their collective industrial strength through trade fee scale for the partners than in a mandatory minimum salary scale for the 90 per cent of the profession who are salaried. Farago of fallacies Salaried staffs must grasp these facts fast, as the Movement. ‘The Monopolies Commission Report—A Straight Forward Guide’, pull-out feature inSLATE 5, also the full NAM-report ‘Do not pass go—DO NOT Collect (4° Both from 9, Poland Street, London, W.1. John Allan justify such lucrative fees... and pay the salaries to get it! of the professions most lucrative big firms weren't Reveille even included in the survey!) The point to remember is that though big practices are less numerous than small ones, they nevertheless In condemning the existing fee system the employ most building design staff. This means Monopolies Commission has unwittingly helped quite bluntly that most architectural workers are Point the way for salaried staff in architectural busy carning the largest profits for their offices to better conditions. For years the system employers little of which is ever passed on to has been operated by principals for principals. themselves. Willstaffallowanewsystemtooperatelikewise? Many staff are now beginning to remedy this situation by organising in TASS. They are less Readers wishing to pursue this subject further are likely to be interested in a mandatory minimum referred to matcrial published by the New Architecture The minimum fee scale may help the partners In this issue we start o special insert on the major issues affecting building design staff. We hope readers will keep these inserts and build them up into a library and thus in time give members demands an authority which they would otherwise not have inthis issue, welookat the Monopolies Commission Report, Pensions, and the Government's recent Green Poperon Housing. Ideas and articles for future features are most welcome discovered that the revenue yielded by the present fee system has not been equitably distributed to provide architectural staff with salaries com- Percentages of construction costs. But how much parable with those in other occupations at similar do staff know about salaries, overheads, and levels of qualification, experience and respon- partners profits? Often the easiest way to begin is scales, ownsalaries.(Thosewhoneverbeforehaveare The average profit per prinicpal in all usually quite surprised at what they learn). The partnerships (including the many small ones next step is to organise in TASS, achieve union’ without staff where fee income relates more recognition and press for “open books’ in orderto closely to costs) was estimated at nearly £13,000 give staff a clear understanding of the firm's overnment the kind of pressure w! better 3. Everyone knows the present fee system of The Government Housing Green Paper reafirms to people who have ben defined in some way ms propesedistometexceptionalneds ment, housing and political party and housing case following increasing general afluence, the| for the workers. The aiim was to show that good cheapertobuildandcanbebuilttohigher Crossland’sviews,theLabourGovernmentnow|,yeresetatalevelwhichevenartisans thatrents similartothosedesignedforsocialcontrol.19th intopublicsectorhousingstandards.Thiswil foptionof th speculative housing market. These are below those whichhavebeeninforceinthepublicsectorsince maxima. Any reduction’ willcertainly mean a loweringofquality.Intheprivatesectoritmaybe thatacouplecanbuya3or4personunitandthata 4personfamilycanbuya5or6personunit.Thisis not, however, the case in the public sector, wl 4personfamilywouldordinarilybeallocateda4 makagreatrdeal.sIf,youareconcernedabout oo about the|compensateforthelowerspacestandard Property, and perhapsadifferent area. ust be repaired adequately in order to achieve Neaparticulardutytoprovide forthasewhocouldnot goalofsociety.Individualsgouptheladderone Tung atatime. werebased,arguedstronglyforhouseswith gardens rather than flats. This predisposal towards runing through bour | From the Peabody tenements of the 1870's to Herbert Morrison's LCC flats of the 1930's, nd then fo the tower blocks of Birmingham Slasgow in the 1960's, one can se only a slippery line of descent from one optimistic | ‘solution’ of the housing problem to the next; each one increasingly inhumane and inflexi- ble, and each more rapidly becoming ob- solete. The Peabodies were slums in 70 years; The Morrison flats in les than 40. With | sing speed of improvement in the standard of livingou,r bravetower blocks are | likely to haye an acceptable life of bately 20. years—only athirdofthewaythroughthe | repayment of the instalments on the loans by which they are built. The Government Green Paper ‘Housing ative Document’ afforded an oppor- tunityfora radicalreappraisalofwhatwe buildandhowwefinanceit.The GrenPaper isadisappointment. Itmakes very few and in some cases damaging and discriminatory proposals for solving the housing problem. We as architects, planners, engineers and surveyors cannot aford to sit on the fance. tion that itis adapt someand ies—of theplaces we live in—in the light of radicaly changed conditionsoftodayand tomorow.Wilthe public good prevail, orwill profit motives {both private and public developer al |override public interests and amenities by squeezing the last ounce of revenue out of the development at the expense of quality and a civilised environment? Labour government Therelationshipsbetweenhousingandgovern of the cotage style. The cheapest plan fo rectanglelaidouttothehighestdensityallowedby abourGovernmentinthe1960'sandinthe1977 sanitationandadequateworkerhousingwere Although the planning authority together with that commen- Green Paper have attempted a more extensive | compatible with a fair return on capital. But the the gate is long discarded, many suratewithmarketdemands.Butalthoughterraces integrationofthetwocultures. Infollowing||isingcostofcentralarealandmeant Presentdayhousingschemesdisplayfeatures formandpoliticalpartymayberegardednot | merely as a result of political party policies, but as part of an overall pattern of how cultural densitics, they account for only a third of owner appears to believe that clas differences and, thus, | {ford could barely uses. Detached and semi-detached opposing cultural ideas have lafgely been sub~ Tegulations, but in the social knowledge of designers, relationiships are established and reproduced, in’perpetuating existing social arraisbements togetheraccountfor67percentofowneroccupied sumed into one general dominant culture, | |‘Thee«combined efforts of commerce societyproducesideaswhichfurtherthedominant houses, Thereisthusacorresponbedtewenencethe Followingthislineofargument,emphasis philanthropyandcharityhardlymadeanyimpres- oneortheotherformoftenurecan on|sionontheproblem.Loacndacenltralgovernment emphasis on one or the otheronlybeseen as_|,became involved inhousing through asuccession dassandarerepresentedastheonlyrationaland universally valid ones. These ideas, attitudes and ideas of individuality and the desirabi sed both in terms of cost and the culture. The|oftumclearancelegislation.Eventually,theywere GovernmentGreenPapertacitlyacceptsthatview|forcedtofinancehousingandbuilding,théfirst aCDPpublication‘WhateverhappenedtoCouncil formadominantculture Themostimportantoftheseideas,accordingto Jacksonnotesthatinthe19thcentury‘most whichsaysthatsocietyisnotdividedintoopposing)councilestatebeing193threeroomeddwellings classes, but it is a continuation of individuals | opened in Liverpool in 1875. Seven years later the rankedinorderofmerit.Thewinnersgetdetached|LCCobtainedpermissiontobuild,inLimehouse vilas.Thelosersgetcouncilhouses. Raymond Williams, is a belief in individualism. knew exactly what their potential Thecorrespon igideainthefioefhloudsingisthe |customersrequired.Assiduously,oftenclumsily, 197GovermentGreenPaper‘Housing,a conceptofprivateownership.Thepotential theystrovetoevokeatleastasuggestionofthat thefirstcouncilestateinLondon.lance 2 nypeoplethekindofhometheyward This view, which promotes owner occupation tothe In PrOCES, onlyofhowtheexpandingworkerpopulationwas|AddisonActlaunchedthecountry’sfirstfulscale architectatthedrawingboardtotheapprenticoen housingprojectstoday,thenjoinTASandwith yourcoleagues,workforabeterfuture. oppositionbetweentherighofttsheindividualand the limiting of private ownership is resolved by a further concept—that of the idea of permanent scarcity associated with success through individual meritachievedincompetitionwith otherin dividuals. Society may then be considered as a continuumwiththesuccessfulatonepoleandthe this‘safeguard’doesnotexist,Anditisherethat housedbutofhowtheyandthemiddleclas}housingprogramme.By1915lackofhousesfor summarises conyentionalwixdam.Atthesametimecouncilhousing inadequateattheother.Inbetweenisaseriesof government policiescanbescenoperatingto isrelegatedtohomesforsociety'sdeprived. stratifications,ofhurdlestobeovercomeenroute. controlthebuiltform.TheTudorWaltersReport, perceivedtheproblem. Theappearanceofcholera|renthadbecomeacute.Houserentsrosesteeply whichscourgedthepopulationwithoutregardfor|andtheresultingdemonstrationsbyaggrieved Althoughthegovernmentproposesthepartial ‘Decayinginercityareasmustberevived.Thiswil clasorlocalitybroughttoattentiontheextentof|tenantsinGlasgow‘camenearenoughtothe restorationofpastcutsinexpenditurethiswilstilrequirehighinvestmentwhichmustbemadenow.’ *replacementoftherofcoveringandrepairing theproblemwhichalreadyexistedandwhichgrew|appearanceofrevolutionathomewhiletheamounttoonly£830milionofthe£1.30milion ThisistheesenceoftheresponofsteheTASS- andstrengtheningoftherofstruc asthepopulationexpanded.Itwasaproblemof|countrywasatwarinEuropetofrightenthe BDSLondonBranchtotheGovernment's ©stabilisingtheexternalfabric; thedistributionofdwellingsandadeclineinthe|Government’intopassingtheRentandMortgage Sinceaurgeproportionofarchitecturalstaf HousingGrenPapTeherGr.eenPapisearwide efficiencyofpublicservices,especiallywater|RestrictionsAct1915.Rentswerenowfixedat workonhoustihenovger,allefectwilcontinueto rangingdocumentreviewingalaspeofchotusing supplyandwastedisposal suchalevelthatprivatespeculatorsnolongermeanalossofjobs.Ithepublicsector,somelocal policybothinthepublicandprivatesectorandhas honities.newtownsandhousingaxsociations Thesuccessfulendoftheladderisheldtobethe onwhichthedesignsforthefirstcouncilhouses Furthermore, relations between individuals are indirect, mediatedbymoney,sothatthewhole starts social organisation can readily be thought ofas a governmenthousingpoliciesexceptforabreakin ‘aggregaitecadnbesenthatforthefirsttimeaLabour marketpluor.Thehousingmarketcanbeandis jeramenthaspresidedoverasituationwheremore overlaidonthiscontinuum.Thetenuranedformof Between1919and1927forexampleaperiodof WriterslikeStedmanJoneshavedescribedhow|founditeconomictobuildforrenttoworkers.The authorityarchitectsdepartments(mostrecently Onlythencanitbeimproved.Ifthisisnot deepeninglabourinfluence85percentofcouncil petvatethanpublicsectorhousesarebeingrenovatedor housingmustreinforcetheideasofthedominant houseswereofthecottagetype.Between1930and Thediferencefsstilsmall—210,000private culture.Justbecauseoftheveryimmediacyofthe 1939underacoalitiongovernment,Jesthan7per sanitary,socialandmoralquestionswereinex-|governmentconcludedthatitcouldnolongerlook HillingdonandYork)arealreadysubjectto TheBranchbelievesthatthePaperwastedan possiblenowwhatwilafurtherreductionin century,boweverbriefly,matykestlb_ninatetheirsue. betwenthenatureofthegovernmentinoficeand Rangedagainstthis,speculativehousing,bothin and high sensity flats for council tenants are the hal marks of their public sector housing policies, the a policy of high density city centre for al subsequent housing legislation. There| flated tenements linked to slum clearance. This ©wasalsoalink,whetherdirectorindirect |between the built form of council h Anon-traditionalformofhighdensity associated on the one hand with slum clearance and cottage idiom, has been linked to g operationandinbuiltform,expressesvery trolledmoreandmorepreciselythelayoutand|establishedbythedesignersofthe19thcentury ; Aggregationofthehousinguni modeldwellings. . “basicstandard”ratherthanmakea‘fulimprove- ment’asdonenow,toasmallernumber. buit asthe visiblecontextcorrespond toand reinforce these overall ideas which we take for granted. whilstlimitingthedebatewithinunnecessarily vertedfor£10,f0ive0or0sixyearsago(pritotrhe 1974 Housing Act) arenow having major repairs They also critisiced it for emphasising owner carried out at costs up to£5,000. Not onlyis this a deper occupationastheprimaryformoftenurewhilst veryhighmaintenancecostbutitdoesn’ttakeinto The form of the speculative house iscontrolled Itisreproduced and reinforces Although the 1890 Housing of the Working ClassesActgavethelocalauthoritiesthepowerto Thehistoryofhousinginthe19thcentury,asinthe| acquirelandandtobuild,houseprovisiondidnot 20th,isessentiallyanurbanone,Itisarecordnot|becomeastatutorydutyuntil1919whenthe Private sector by future extension thelikelyefectsoftheGovernments quick,comer-cuttingquantitativeapproachto impossibleinthepublicsectorwhereth centofcouncilhousesbuiltwereofthecottage happenedcanonlybeanswredbysituatingthewhole Councilhousingdoesnotreinforcethedomi- designguidesandstatementshavefavoureda TheGovernmentintervenedin1844byin-|government'shousingpolicyprogramme fnthefactthatithasoccurredatal This break with pre-1964 Labour Government houningpolicesisintriguing.Theobviousquestionwhat welasofilhealth i BolshevismtoprodtheCabinetintoacceptinghis thanlosofjobs.Localauthoritystafwilbecome restrictingcouncilhousingtopeoplewhohave nantculturebutisinopposititonitinanumberof traditionalformwithalimitofthreestoreys, ways.Itisinfactaformofhousingwhich Emphasisonrehabilitationcompletesthepicture represents the ideas of an oppositional culture Conservative administrators seck to reinforce troducingtheLondonMetropolitanBuildingAct| By1919also,thetwobuscformsofworkers whichfor the first time imposed restrictions onthe | housing had already been established. The Tudor way buildings could be related to each other, | Walters Committee of 1918 recommended subur- minimumstreetwidths,lightingandventilationof|banlowdensitycottages.Until1964thiswas habitable rooms. This Act was followed by the | Labour's approach to council housing. Conser- PublicHealthAct1845whichlaidthefoundation| ¥ativesfavoured increasinglydemoralisedastheyscetheirofices experimentation will be frustrated by lack of funds, so architects and beendefinedinsomewaysasdisadvantageous, ©thedisplacementofestablished Councilhousingisremovedfromthemarket theideasofthedominantculture.Slumclearance ©thelosofrentswhilework isc: The Union is opposed to any lowering of standards. These reductions are in effect already “Therearestil9.2milionpeopleinBritain takingplace.TheHousingCorporationhasissued livinginhousingunfitforhumanhabitation, guidance notes to housing associations reductions in specifications for rehabilitation in order that more conversions can be achievedusing the same money. A number of housing associations fear that, by freezing the Housing Association grants and keeping yardstick increases to a rate lower than that needed to keep pace with inflation Oncebuiltitdoesnotbecome acommodity,buti solely for use. Secondly with its pooled bistoric costsete.council housingexpressestheideasof collectively rather than individualism. Houses are not achieved by success on the ladder of society squalid. The new high density developmentofcouncilflatscompetewithowner precisclytheideasofindividualismandsuccess occupationneitherinquantitynorinbuiltform. from acontinuingfallin.workloadandhence through individual merit, the success being measured by value. In council housing, use predominates,Intheprivatemarket,valueisthe criterion The Conservative problem, however, is how to avoidsocialunrestamongstthosewhocannot compete in the housing market. For Labour the problem ismore dificult. Ifthey perform their The early Acts, included provision for demoli- | | An examination of contemporary 19th century tion,stretclearance,accordingtoStedmanJones,| literatureonthesubjectrevealsthatanapparently wereinbredwithalmostmagicalefficiency.A|functionalsolutiontoaphysicalproblem reading of housing history shows how successive was in Insocietywherevalueisthecriterioncouncil functionasagovernmenttheyadvathenidceaesof fact rooted in ideas about social control. Model Conservative governments until the 1960's also | dwellings were designed to enable easy and turnedtoslumclearanceinaneforttocontrolthe| ¢fectivesupervision —‘regulationwithoutdirect nature and appearance ofworker livingconditions. | control’ as itwas caled. The frontages therefore Butdemolitionexacerbatedtheproblem.Thepoor facedontoasquareratherthanastret.Therewere did not disperse a limited number of access stairs and in many cases formers turned towards the problem of who | the one entrance and exit from the square was lacking baths, hot water, inside lavatories, or innedofmajorrepairs.The(Housing)Green Paper isnot worth the paper itiswriten on until and unles the cuts in housing are housing does not conform and may thus considered a threat to the dominant culture. Conservative governments are likely to suppress council housing and Labour governments to further it the dominant culture, Insofar as they support the oppositional culture and its ideas they are in integrate the two cultures by producing council jhousing which adheres in form, but not in tenure, iotheideasofthedominantculture and this trend is likely to continue. Many architects Form,however,issecondarytotenure.Inwhic! takinga‘lowestcommondenominator’approach authoritiestheintroductionofgreaterfl Upa blind alle tricablylinkedtothequestionofhousingthepor.|toprivateenterprisetoprovidethegoodquality Themiddleclasbelievedthatthebringing|homesprotomtheiretusrninegsodldiers.The1919 togetherofthepoorinlargenumbers,inareaslike|ActwasalsoinfluencedbytheHunterand theLondon Rookerwhieresth,ere waslitleorno | Salisbury Commission, aided according to Enid access by the middle clas, created a danger of| Gauldic, by Lloyd George who used the dangerosf and—bureaucratic spendinggiveus?InonewelrespectedLondon . The opportunitytoreappraisethecountry’shousing housingassociationpropertiesboughtandcon igners wil by pushed more and more into followedaseriesofActs(descnbedindetailby|policyculminatedinthetowerandslabblocksof applyingstandardplansandstandardformulae. Theyreomldohousvinge whichis,intheirterms, EnidGauldiein‘CruelHabitations’whichcon-|the19$0sand1960s.The geneictypewas Theprivatesectormayalsobeexpectedtosuffer possiblebyimproving’thesehousteosanadequate working in private practices, wil hesitate about moralrulesregardingbothfamilylifeandhome- workingforthepackagedeaker—whomtheyseeas falingbackontheGreenPaper therebylabellingthepublicsectorassecondclas Promised in the Green Paper would also result ina reduction in the quality of housing provided both innew construction and inrehabilitation. Itaims Another worrying resultofcutbacks expenditure isthedisastrousefecttheyha unemployment, but they also result in lowering of it The built form also. The ofhousing ‘speculative’house seemstobe which appearsrelated as an archetype througtheocountry isadevelopment should provide housing for the poor how itshould | controlled by a gate locked at 11,00pm. Strict be financed and managed, and what standards of accommodation should be provided. Private { working completed a picture of the Victorian philantrhopists elected to build model dwellings } middleclasses’ determitonianctulicatoenthe ideas | There was theflat rate old age persion scheme, |whicheverybodyere butwhichno-one relied upon unless they 0. | ‘Therewasthegraduatedpensionscheme,which no-oOneseetmohsave underosrrteloiedoudpon | with any confidence. ; Now we have the new State Pension Scheme, introduced by the 1975 Social Security Pensons Act, which is not impossble to understand, and doesseemtoprovideareasopensiaonbfolremost people, The new State scheme, which becomes effective on 6 April 1978 scts out to guarantee that al employed people will get a pension on retirement. For those people whose working life conforms to a certain idea of ‘normality’ this will be a pension \on retirement which issufficient tomaintain astyle |oflifecomparable totheonethey‘enjoyed’ whilst s ers Theamountofcontributionandne ATTA 1 ae eeab they within ¢ertain limits, But the Rove orfpeasion is not determined by mnominal cash carnings. It is determined by the value of carnings. On retirement, the amount of pension having been established, its value ts then main- ined irrespective of inflation. That, at Jeast, is the upoftwoclements Thereis nt availab >all wh have almost all heir p sbasiic pension sadjust es in its purchasing pov you ret re or G compulsory state scheme. to the In doing this they will elemen ating to the value of tain| mit. W an indivadua entagetheiractu: earnings(uptc altuoaellodwfor ee S a »make some allowance f inflation. mitof earnngswhichwill contribute the same contribution as before if the scheme is similar but the pension received from the second employment will be reduced to three quarters (it will relate to 30 and not 40 years) and the frozen pension from the first employment will yield about onetwelthratherthanthequarterwhichisneeded to bring it up to its expected level. The more an employee changes jobs the greater the rate of inflation, the less pension is received on retirement. What is the solution of this difficulty? If one Private pension scheme were to be adopted by the majority of employees in the private building design sector, then transfer of pensions would be facilitated and they would not have to befrozen when employees changed jobs, The Architects Benevolent Pension Fund Trust offer a scheme of this sort, but it has to date been adopted by only forty offices. In many offices the Pension scheme chosen is an extension of insurance schemes already selected by the Principals which may explain the multiplicity of pension arrangements. It seems that itisdifficult to designa Private scheme which suits both large and small offices. Will you still pay eC you? The ways of government me carmings related clement is also departments are strange. The only way to find the d periodically. The scheme, which came answer to this question is to ask, with caution on 6 Apnil, fixes the upper limit at Most employers wil, by now, have decided tannum. So, if TASS-BDS does whether tocontract out or An employer who ost building design staff should be contracts out of the state Pension scheme has to king for some means of topping up their state proportions and How You Benefit’. If you want tc is that the DHSS computer doe tbl W Up just as produce enough children Unfortunate! not benefit from the contributions which the employer makes to an occupational scheme and it is unlikely employces will really be able to squeeze the equivalent cash from the employer as extra salary senior citizen utopia for al protra | educa Cement reduced have a The solution to these difficulties is obviously not clear, but it may be that the majority of large offices could be persuaded to adopt one main scheme, and that employees working in small offices might choose to rely on the state pension scheme plus individual life insurance, at least during thecarly The Xplains at what point you cross the nts on part of their working lives when they are most likely to change jobs. What carnings Avetleeaty tiwevl Employees can refuse to join occupational pension schemes and buy insurance to provide any benefits that they require in addition Pensions! The mere mention of the subject brings # glazed kook into eyes that have not scenthirty |summers and a distracted and nervous twitch to i |those that have seen more than forty. The Radio Times usedto carry an advertisement for lifeinsurance showing adapperchap oftwenty saying‘ItscleikemasprettygoodjobbutIhear |they don’t have a scheme’, As time passed |hegraduallybecaamsiextyeho erie fora pe purse of trancuilisers : |asteror ichwusfrelyavailablethen)tearing | at his scalp und saying ‘only five years fo go to retirement. What am Igoing todo? Itwouldhave beenfunnyifithadnotbesoetragnicallytrtuoleife. | The State Pension scheme has gradually |improved since the days whe, ifyou ork) Tos | worked until you were no longer fit, and were | sent to the workhouse hospital oto live on the Rubican. It does not tel what happens if you do! Provide an alternative pension scheme which meets the criteria laid down by the DHSS. The contrib- a OFJoininganoccupationalpensionscheme,orbytuionstothestateschemearethenredutcoaefdlat putting pennies under the mattress rate. The contracted out scheme must Provide a The whole c related \ conseque! of the new state scheme is guaranteed minimum pension which is the sameas F than cash amounts, and isthe pension which would have been Provided under ner fluid. The actual figures, the state scheme. It will usually provide benefits that the guaranteed minimum and the contnibutions will be greater than those required by thestatescheme. Ifforsome reasonacontracted this scheme does not provide a Those who are self- employed or who work aborad or whc 1contributionand benefitaresetout in the DHSS leaflet NP30 ‘New Pensions acted period of self-discovery and informal n for too long wil find their pension I'm 64 pensions. This can be done by buying life insurance Predict the value of your state pension you will out scheme can be seen to fail to work in an © read the leaflet with your own case in mind ndividual employees case there is Provision for the Set out what you ¢ * to carn on the basis of private scheme to make a payment direct to the Present s: scales, a ic ¢ what you will DHSS to compensate for the reduced con- getintermsofcurrentvalue.Allyoucanhopether tributions,andtheindividualis“boughtback’into you would get a proportion of the pension wouldn't the state scheme some Government doesn't start The benefits provided by a Private “contracted fiddling theindex to control money Supply through out’ pension scheme are additiofial to the basic pensions, or that the predicted diminiti Population doesn't rebel at maintain enormous retired population which state pension and are only substituted for the carmings related element of the state pension. So the level of your notional state Pension not only affects the ount of benefit from the private scheme through the guaranteed minimum but you will actually be trotting along to the Post Office to collect one part of your Pension from the state whilst receiving separate Payments from the Private scheme. It seems that there will also be some arrangement as yet undefined, whereby the incre the notional related element of your pension will be paid to your direct of the We understand that the DHSS wil notgive general by the DHSS. Anyone who has changed jobs and 1 the best wenty information about these cases but will o belongs to several different contracted out schemes ye carnings. This element of the consider each indiv dual enquiry. It is implied that will surely be receiving pennies from all con- pen $salsosubsequentlyadjustedafterretire-youwillloseallrigtohatstsatepensionbutsurelyceivabledirections. Employers can elect not to contract out but to run a private pension scheme. In fact, the purpose of the private schemes, whether contracted in or out, must be to provide additional benefit. This additional benefit can be some means of providing @ pension which relates to salaries over the upper limit of £5,500 pa, or Providing additional dependents pension, or sickness benefit, or lump sum payment on death in service, or some combination of these benefits. One additional facility which most private schemes offer is that a Proportion of the benefit can be taken on retirement as a lump sum. There is, however, one aspect where the state pension scheme will have an advantage over the private scheme There is only one state scheme. It does not tic an employee to any particular employer. When an employed person who joins a Private pension scheme and subsequently moves after, say, five years to another office with a different private scheme the pension relating to that employment is either frozen or if it can be transferred to the scheme at the new place of work, there will probably be ‘administrative charges’ deducted from the fund which is transferred. Most Private schemes are fined by nominal cash amounts rather than value, that is, the benefits are determined as a Proportion of te average of a small number of best years actual salary and the length of service. An employee who stays with the same firm for 40 years fromtheageof25toretiarndeismaememnbetrof the pension scheme will receive a level of benefit which probably will be determined in Practice by some of the final ten years, Ifthe employee belongs to one scheme for 10 years from the age of 2S and another scheme for the next 30 years he will make Creator An entity primarily responsible for making the resource Several authors Source A related resource from which the described resource is derived John Allan Date A point or period of time associated with an event in the lifecycle of the resource May 1978 https://nam.maydayrooms.org/files/original/e9d8184aaaf53a2abdb044d1a9074d7b.pdf 7663b4a3788e9ef8ceb34fb6510298d7 Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Alternative Practice Description An account of the resource This investigated other forms of organisation of architects' offices based around the concept of cooperative working and shared equity. Several members went on to establish their own practices adopting such models. A pre-eminent example was Support Community Building Design, which emerged from a small group of graduates from the Architectural Association which went on to create a cooperative practice focused on potential client groups in society which traditionally were not the beneficiaries of the architectural profession which, we would have said, was essentially the handmaiden of capital. These groups eventually included local authority tenants, women's groups including refuges, ‘black’ i.e. racially self-defined groups. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Support Newsletter 1 Subject The topic of the resource Newsletter 13pp Description An account of the resource SIJI%DOAT newsletter 1977 Futlished and written by the Support Group nark Girason, „arrns, illnsle-• Colin T. a-erlor, "oolley ( teäporar" Q(idress) QC, Church noad, London 9P'Ä. Telephones: 01 965 10 or 27. iz Suoport? ?age 3Ilow Cupport Be e:an. 3. The Current Situ-ationo 5Support Projects. 50 ?.elationship ?areCoe,unity Architecture' 9 7. The -•uture 0-0 10 Alternatives in Gousir•• (.1 report on Self Juild in Dritain). The views expressed in this document do not necessarily reflect the collective viewpoint of all Support mernbers, but ideas under discussion e 13 SUPPORT? It is currently an inforrral organisation of like minded people with a background in architecture, building, housing and planning. We are concerned with: proraoting socially resporsible work in these fields. developing alternatives to current professional ways of working. developing social and political work that Will bring benificial chances for the majority of people who, at present, have no control over the resources that produce and shape the built environment. to discuss the theoretical and practical issues that these involve. Support is both simple and comple%. It has developed in response to a sireple need of many organisations to find sympathetic and responsible 'experts' to work with them on buildings housing ana planning problems. then such grours as tenants associations, voluntary, self help, under— " priveleged croups and connunity advice and action centres think they need architect'-xal, buildinc or similar advice, it is often hard for them to find experts they can trust and who share similar objectives. In addition there are many new grouy•s with access to resources, like tenant co-operatives who find conventional professional services unsatisfactory. There are a crowin'" nnmber of asenciec dispensing assistance on welfa•e rights, the law, sonle aspects of housin— often through radical departures from conventional practice, many with official financial support, but it is only through chance or personal contact that useful help from an architect (for instance) can be found. in additions such croups often have difficulty finding the money to employ their own professionals and as we describe belove' there are many dangers in relyin€ on voluntary help uithout a well organised structure. Support is concerned with getting to grips with these problems, finding sympathetic experts to help groups and finding ways in which such experts can earn a living doing socially useful and responsible work. The demand is there and there are a few, though not enough 'experts t with the experience and ability to :neet it, The more complex side to Support appears when one asks why should 9C,; of the population be in a situation where conventional professional practices are of Ij.ttle use to them? .1hy should a growing number of youns professionals reject the methods of working that they have been trained for? What new principles shoulel emerge to structure the way society organises and uses specialised services? Developing a critique of pro-e.?.aioaali-sra and tryins to work with I-ew principles is more difficul€.• It raises trany issues about ideoloe•or and social change. it involves a comr;ittment to challenge current assumptions about the way things are done, codec of conduct, the mystique o: professional expertise and the relationship we all have to our work. The idea we have is that Support will retuin a cæparitavely ,smll informal organisation not a prozeure group in the conventional sen.ze, with a large ruernbership, nor will it be a conventional commercial firm. An adequate pressure srovp in the form of the new architecture iovernent alreadj- exists. Instead Support members will be involved in carrying out work which will be monitored and carefully anal;sed with each 2. member rharinc experience:z and di.acagsinc broader problems and Ciihe ideas developed will be spread by example and through research and publicati.ons, based on the practical experience of a workable service to meet speci.ic neeus. As we become more fIvent at explaining ourselves, briefer statements setting out the principles v.'iII emerge, but for the time being occasional publications such as this will e:cpLain the work and ideas in course of development. This newsletter doesn't represent a complete statement of our position and important caps will be filled in future newsletters. 2. GUPPCRT Support bec2n with discussions between a small group of staff and students in the Architectural Associaticn O chool o: Architecture (10k) about alterrative ways we co'ald worki outside an educational institution. Cne of the naira features of the 'unit t we were part of in the A. A. vas that students work involved puttint sone of the Support, ideas into practice through t live projects'. A great deal '.:as learnt from the Glistakes and achi everaents of thece projects 'out we were always inahibited by the pressure to confor:a to more traditional requiremezts, assessrnent and a different view of architecture which prevailed in the college as a whole. Current thinl:inc in architecture and architectural education will be a further discussion in future newsletters as there ic an increasing polarisation between those Who talk of architecture' and those with more cli Sist approach. Li-:e pro*cct work by Etuder.tz in the A.A. included:— 1 ) work with residents in a ilarringay Il. A..l. 2) with a resi,tent a-soc in a Zambetli }I.Ä.Å, 3) a repo:t on squatting. research on co—ops. work on rehab with association in a Urent G.I.Å. Desi-3i and helping to erect temporary building• with a o•roup of volunteers in owindon. the completion of report on self build housing. other interests included rural development in cngland studies of and traditional materials, chort life hous.inc. beginnings of work, with a group converting w•xrehouse in P,o+.herhitlaeo Currently students in the A .A. Unit 2 are working on:— 1 ) dtudies of a housing action area in Brent 2) .!ork in an in L eumbeth. A study of low cost conversion of industrial property in &ast London with the Joint Docklands Group. Vlork with a tenants in Southwark. ..'ork with the Community groups in the Isle of Dogs. It is not unusual for such student projec%s to continue beyond the academic year but because cf the voluntary rature of the students contribution, all sorts of problems can arise, another issue to be diccussed in more detail below/later. The result of this work taught us thnt an icr,portant distinction had to be trnde between work student— could do and a large der:nnd for help that couldn f t be dealt with by therne In addition the ideals, principles and political objectives discussed in college become much harder to apply, when thrust into the 'real world . Support, therefore, would be a moans to link experts, often isolated around the country — supporting them through opportunities to meet and discuss comrno'-l The links with the Architectural Acaociation are however, on the one hand marro' croups approach the A.A. lookin o• for the sort of help Support members can give. In addition we are able to give students the opportunity to corne into contact with our ideas. On the other hand wc are not keen to be associated %ith other work going on at the A. A. gorae Support members will continue to teach at the but it is hoped that Support itself will have a sepamte base. 'u'ith the dispersal of members of Unit 11 in the sunracr and the uncertainty of mny peoples' immediate 5 of us felt the need to form a workirac party to try and develop the idea of Sun,ort. w e have found that small selfdi.fici.plined meetings where we stick (by and lance) to an ac,enda and keep minutes has a 1101%'ed us to make a lot of progress. %'here have been 7 meetings since veptember 1976 and they large-my consider the following: 1 . Requests and enquiries that come in through variety of channels — to the A. A. , contacts etc., usually people asking for information, advice or needing building or architectural work done. discuss •,lho could handle such requests. Often this means coir-g back for more information and explaining to people that where are no soup kitchens' with unlimited nuraher.3 of voluntary helpers to assist a group. i;'e also have to explain that the architect and other j professional t T,embers are bound by law to work to a minimum fee scale we Ina-or not agree with it but we are not yet confident enough to Vick fights with bodies like the 2.1.z.A. }iowever, there are ways to find help or funds Cor Groups with very little money. In addition, number of other architect3 have established the ri"ht to provide free or flexi 'oly priced services to low income people and it i 5 likely that these arrangements may receive more fcr:nql recognition 'oefore longs 2. Je discuss people who might be able So take on work who we trust and can recommead because their abilities nvatch the 'clients' needs. have been able to find help for people as far apart as South ,/ales and London so far. Ile discuss work in progress i.e. any projecte that have come about as a result of a ;3upport contact. ,lho isworking on it, what problems are there, uh-at should be donet Ile discuss general issues about working and professionalism. •J e swap information about meetings, publications etc. , of interest. 6. There is also a crowing load of administrative work, all of which is undertaken on a voluntary basis with minimal funds (such as the production of this newsletter) . To date wc have resisted suggec.tions about forming a co—op, a company or association etc. , because Support GO far relies on trust and communication. There is little point in hiding behind an institutional label when the aims of the organization arei-n conctant developrnent , however the need to e,3ta'oIish things on a slightly more business like level are discussed below tocether with c'ar ideas on how the or-anisation might function in the future. Any work taken on through Support is taken on by individual meznbers singly or in geoups, contracting directly with their client. Support does not enter into any business relationship i!ith people needing survi ces Its members therefore have their own business or architectural practice. It has not been feasible to l:eep everyone in touch with the way things Inve developed and we 'nave generally relied on people taking the initiative themse Ives to find out what is happening. we felt it necessary to arrange the raeeting on I'larch 5th to bring everyone together and discuss recent develorrnents. This is a list of work undertaken by Support members with very brief descriptions of what the work iavolves. ..'e hope to publish material from time to time in this newsletter or as special papers about work ctkrri.ed out. haven 't listed here the many requests and enquiries that have been discussed at, Support meeting,3, which haven't led to projects 30 Law Centre — survey work to aid tenant, funded by Green Scheme, in council ovmed damp house, taking council to court. South dales ?overty action Carapxiga — Job creation sch erae in ,löercarni.d, co—ordinator to work on rehab and conversion o? a connunity building funded •J.C.r. Full tirne employment. Dri.dse Road i ,odernisation, Drent — advice to tenants association on inadequately annaged scheme to rehabilitate 32 council flats, with I-Brent Cornrnunity Law Centre — no fundc av.aj.lab]e. Brent Active Pensioners aud Disabled leople Day Centreo Plans and advice on conversion of cid church hall — will lead to help with building work funded by urban aid. ct. "ignes Place, nbeth — rehabilitation feasibility study. Survey and production of report about 1+9 houses to be demolished for a park. Part of a study called • IGaining Ground" bein• carried out by Garth Resources Research Limited, funds from trusts to E. R.R. 5. Architects could be homes for thirty years st Agnes to husband housing from Buckingham 10i. ecratc shortage of accommoda. La mbe•thv co uncil•c has moving out tenants and leav. commended demolition of the ing the houses empty to st dwellings. parkland on the site of the submitted t•.ith houses and the min. is nearlyoruens]olra. to tained the houses. that the The residents council sulitaVb!el says for shlllthelm •are pr.omptcd by its desire deal The architects say the cost of rehabilitation has been Mr Tom on and Walls l report Colin Taylorthe instructions prepared the of houses, mainly St Agnes withthree-storey Place consists terrace of 49 haveb been weakened wrecking biofn• SqumEarth Resources Research Ltd, units. Built in the nineteenth da mageu h{aas edeen uctausbcYd •bthy SQUATTERS SCUFFLE with police a: they try to stop the demolition in st Agnes Place, Kennington, after New threat to St Agnes Place " half of Lambeth ratepayers. GLC, of there collusion.could be no ques- " DANGEROUS STRUCTURES notices were served on Lambeth Before starting work. the CounCouncil last Friday. in a new cil knew an injunction was development saga, in writes the St RosemaryAgnes beang in three sought. parts Cranes. of the breach workingstreet,of Place street of Victonan days earlier, housesthe used demolition methods codes.in the council Righter. Two 49 Wednesday, The notices, under served the by Lambeththe dis- Tuesday Lambethiniunetion against which extension them. agreed of in theona trjct surveyor London to the Building Acts, require tion notices give Lambeth the The of securing the damaged option houses letter but recommends the surveyor'sdemoliing to further first-floor demolition level of eight" of tion and with " roof damage. It has four of sanng two small little hope houses.Agnes Place has been at St the centre a borough of fierce With controversy.17.600 in . families because on the of council plans waitingto delist. molish the houses and grass to take down, repaut• or other- (h lemma.Lambeth is responsible Cor the over The the council Site. proposes e',entwise secure " 14 houses. Tlur• teen Lambeth three were hours. on severely January employing darnageql 17, a in underby houses' vote against safety. have demolition. and qith choice a it councilwouldbut ualiy either to link the the tvso penni+ion street: parks but ontoit side of detnoli- appear to little tion team behind a barrier of to shore up the unsafe houses. has close neither the road. nor funds a.%oca. more than 200 police. One house Larnbeth's leader, Alderman Its budget untll the 1980s. pressure had a month been earlier vandalu.ed to prevent by Lambethsquat- evening David be St:mpson. served claimed until who as notices the thus on Fr:daywould'sut ek. ted Local cillors in houses have could beengroups shener and ccun•Latr,• ters tnoving ln. not commented that district the beth's homeless. The destruction was halted by surveyor as employed by the a Court injunction on be- �Carret Lane Law Centre, Wandsworth — New Law eentre converting old building, advice on arguement with D.S. about t structural alterations • Church End Estate (Brent) hrnting study with Brent Inw Centre and liarlesden Advice Centre on heatinc problemc in new council estate with electric ceiling heating. A number of other potential projects are currently under discussion. The central group rnembers keep time sheets on the work they do on the above projects and keep notes on the problems they experience. succest to other people who are working on other projects that they do the In addition •or e keep an information sheet or, each project. One of the key factors in attempting to work outside the limitations of the traditional relationship between the 'expert' and the 'layman the professional and the client, is the need to establish another working relationship which makes completely clear the roles and responsibilities of all involved. Critical to this new definition is the distinction between working in a voluntary capacity, and working in a contractual relationship with others. Acceptance of the contractual principle implies the need for change in the systern to allow a reallocation of control and resources. It also implies a new role for the expert of an 'enabler' with a committment to chare skills and demystify his field of expertise. The model of 'voluntary work' by experts for others is frequently adopted as an alternative to the traditional relationship, and the voluntary approach is well established in British Society. Voluntary work sets up a complex though usually ill—defined relationship between the 'doer' and the 'done—by' At worst, the motives and objectives of the volunteer be fundamentally in contradiction to those he is working with, though this may take time to become evident and the results may be irreversible. It may also prove difficult to refuse further intervention from the volunteer when his true role his been recognised. At best, the relationship can be confusing and wasteful of effort, and even when volunteers attempt to rake themselves accountable to those they are working with it is difficult to avoid an eleraent of paternalism. In order to avoid the pitfalls of voluntary work there must be a 'contractual' relationship of some kind. The normal professional/client relationship is one particularly limit inc form of contractual agreement. It works to a certain degree when an affluent and well—informed client needs an expert to perform a clearly defined task, although the client r.ray well find that the export has not fully answered his needs but that the expert is well protected by his professional status. Establishing contractual relationship need not always require the exchange of noney. host important is a clear statement of what is to be done, and a firm agreement as to who is going to undertake different parts of the work and with what decree of co—ordination. Peayment might be in kind (by an exchange of services or skills), or 'oy access to eome useful resource (i.e. floorspace, use of workshop etc.). 'Jhat is eccential is that there should be a mutually agreed contrac between the expert and the client group (for want of better ternc), and that the client croup is thus able to control the expert or to dispense with his services. 2he lack of this power of hiring and firing is raajor weakness of the voluntnry relationship. The concept of a contract, of a two way exchmnge, is vital in defining a viable wom:ing• relationship. Fcr the client group it alto implies an important chance in its political and economic relationship with 'the system % for it requires El redistribution of control and resources for the client group to be able to employ its own experts. This new relationship will also enable people with skills and expertise to earn a living doing socially responsible and useful work without compromise. Equally important in the definition of a new working relationship is committment to deravstify the area of expertise and to work with rather than for people, so encouraging the redistribution of control. It is easy to slide into an 'advocacy' role with the expert pleading for or standing—in for the actual group. The tendency of the client group will be to accept and rely on expertise without question, while the expert ray be tempted to get on with the solution to a problem in his own terns without expYQining and discussing it. This merely reinforces the alienated status o: experts and increases the dependence of others upon them, rather than enabling all people to broaden their control over their lives by increasing their knowledge and self— confidence. In previouc Support discuscions the tema•, ' cunbler' has develooed ac a useful description of thic new role. a ne enabler is aiming for the very opposite of the profeseional role in opening—up the design and process (in support case / to all whom it effects, rather than privatising information and expertise. It be recognised that this new relationship reguirec considerable enerc-jr .and tirae input by the client croup, and this can be a barrier unless responsibilities and objectives have been erefully discussed at the outset, This relates to the need for a clear 'contract ana to the importance of the client croup establishing control over resources. These on defining a new working relationship have been stated in nn abstract way. Iany of the points will be clearer when discussed in relationship to actual situations in future newslett.e+s, Community architecture is rapi.dly becor:äns a fashionable expression. It is used groups as disparate as 0.2C (Architects Revolutionary Council) and the R.I.iJ.A. It is important that our w.•rk and ideas can be distinguised fron this bandwagon which is inevitably attracting many architects in search for work. Public hostility to r.i0dern architecture has grown in recent years and it is not surprising that the establishment should be looking to inl..rove its image as radical croups er,er€e withiz, the profession. Zhis article deccr.i-bcs briefly some of these developments and future newsletters will deal with ther,i in more detail •The R.I. B.A. has established a community architecture working croup in an attempt, according to 'Building Design', ato win grass roots sympnthyil. Its objective is to gather information on innovations such ac Support and report it back to the R. I. 2.1. Council in June 1977 60 watch out: To this end a meetinz held in 2irminghara recently, to discuss 'cont:.unity architecture It was chaired by Rod Hackney the i'iacclesfield based architect who has established a reputation of working with communities. There was some disatisfaction on how the meeting was organised. Lie cnn supply more details of who was there and what happened, to anyoneinterested. Another group to emerge, Jkillpool, is a referral service with a Lexrge number of women architects which claims to 'serve the community effectively as possible but is primarily concerned with 'putting members in touch with each other for the purposes of obtainins work' (3'.ti1dins Design) . 'Che architects Revolutionary Counéil has close links with the A.Å. but has different aims and :aethods to It organises a community architecture office in the Colne Valley in Yorkshire with the help of the Rowntree ?rust and is holding an :-kC Inter:ntional in July which will cost you .25 or a day to attend. It established the New Architecture *loveraent which has a larce and growing Z'.embership who have rapidly dissociated themselves from Lar:ely supported by young disaffected enplo•jee and unemployed architects, it has produced an impressive number of papers, help several conferences and begun canpaicns to refor.%i the Architects Registration Act (to raalce architecte publicly accountable) and to get employee architects, especially in private offices to join a trade union. Support raeabers ray find it worthwhile to becoroe involved with activities with its broader pressure group objectives. '21kiui plans to hold an open meeting in I,ondon (on Larch 26th probabl") and will shortly be publishing a newsletter. There arc r.ore restrained stirrings in the surveying profession: a nunber of surveyors operate a voluntary work cchæe through Citizens advice 13ureau. k'hile one night have criticism of how it operates it is certainly a need with lese pretentiousness than nany of the architectural groups. For more ir,forrxation about the Groups referred to above contact Communitö' Architecture v/orking Croup, Charles Incr.enn, Royal Institute of 2ritish Architects, 66, Fort land Place, London, Architects levolutionary voancil, 10, Percy Ctreet, London l! .10 new architecture Mcvenent, 143 Whitfield Street, London, • I e Voluntary Zurveyors scheae, (Building and ßstates Surveyors) Dudley Lei rh, 15, ia1f Koon é%reet, Lond0'.u 11.10 The ortyanieation is in -'1 tionrll stage in which we have beon pre—occupied with the content or net, i vit,ir•• than its Il-scioutiornl form. Oe have enthusiacra for its tremendous potential prepared to put a great deal of energy into its development. As several of us need place to work cand support needs base we are setting up an office in the Clerkenwell '!orkshops near the City of London. Clerkenwell workshops is an iuteresting experiment in the provision of low rent working space as of a plan to revitQ1ize decaying inner city area. One P2rt of the building is occupied by snall scale producers, and service industries. The other part is used by ;roups like the 7:Ül+ Theatre Group, Coryunity lction ingazine, the Ghelter C0ä1nunit'J 2ction Tea:n, t Spare Rib' the wonene' nar•-.zine and the Distribution Co—op which distributes publications to alternative bookshops. will send out our full addrecc o.nd telephone number at Clerkenwell shortly. yeoo.le azsociated '„'ith ' hpport t have v:urying desrees of interest and the organisation will need to be amole to opente on two levelc. .orae want to commit themselves to workinty tozether and making a livi1T P"2rt time or even full time fron socially respoasible worlc. 'o•ailt up sor.le experience of What this involves. Others have full titae or are geocraphictllly isolated want to work in their spare time, or be a?le to respond to an occasional request they feel they can turaage. •.1e don't •tnnt to an exclusive croup but the core group of oeople are prepared to ret the office together, participate in reculaa• and frequent raeetin c•s tuncl help to organise or take on work an principles. •This can only happen between people who can develop a good relationship o: trust. 'Zhe wider group of interested people are just as inportant to Support and we need advice on how best to involve ther. •2he onus is on people aore loosely associated to Izeep in touch with us. We can organise occnsional general meetings, send out newsletters, produce papers and publications for sale etc. , but this will need financial aelp. zosentially there are three functions for ?upport: 1 . Operating referral cyztem where enquiries that cone to ,jupyeort can be discussed und people fron the central or wider group with the right skills cr Ijeocr•aphical location are found to take on resulting work. Individuals having diffieulties or needing '.vice or stipport would also contact the centrnl group. 2. ..:e would publish Vipers which would help ilith discussion of ideas and issues. This you-I d inc.l.uae research on particular topicc and pro'D1er..•s "2he office at Cierkenwell would build up infornation bank open to people associated with Surport. 90 IN ?IOUSING: report on Build in The report ' alternativcø in 710usinc? t has gone into its third printing which means that about 800 entogether have been produced. Chey Inve becn distributed through the Zookshop and the rublicztions Distribution Co—op. Je anticipate (hope?) that no :nore will be printed as the dexnnd generated by the various reviews has almost dried up and we have about 300 left at the moment. Inevitably the work on the report has fallen on the shoulders of the Support working party. On several occassions onc or other of uc has been •oked to talk about self build, •so in this way we have been Äb1e to make use of the work done in the It is available for 75p including postage from Jupport.�• SUP}ORT' is shortly to open an office in the Clerkenwell Rorkshops shown in these photographs ( reproduced from Architectural Design ) ) Creator An entity primarily responsible for making the resource Support Newsletter 1 Source A related resource from which the described resource is derived JA Date A point or period of time associated with an event in the lifecycle of the resource March 1977 https://nam.maydayrooms.org/files/original/ffe692c179d6579865e52ba6dca638f0.pdf 9b72e15763391d181a59793fe9a48064 Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Professional Issues Description An account of the resource A cohort of NAM members became engaged with the professional registration body, standing as elected councillors on the Architects Registration Council and its various committees. Hitherto entirely dominated by the RIBA bloc, the Council began to yield to a new dynamic through NAM's involvement, enabling fresh perspectives on such issues as mandatory fee scales, greater lay representation on the body, ethically-based standards of professional conduct, etc. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource ARCUK 'Unattached Architects Subject The topic of the resource "ARCUK 'Unattached Architects" Explanatory paper (6 pp total) Description An account of the resource ARCUK UNATTACHED ARCHI TECTS WHO ARE THEY? Shortl y there wi l l take pl ace the el ecti on of ' unattached ' Counci l l ors for next year ' s Counci l of the Archi tects ' Regi strati on Counci l of the United Kingdom (ARCIJK) . In these el cti ons a group of candi dates present themsel ves to represent those archi tects on the Regi ster who do not belong to any of the consti tuent bodies of ARCIJK which have the r i gh t , under the 1931 Act , to nominate members to Counci l on the basi s of one member f or every 500 (or porti on of 500) of thei r own membership . The most important of these, numeri cal l y , i s the RIBA with 42 members for next year , but al so l i sted are such bodi es as the Archi tectur al Assoc at i on (2 members) , the Facul ty of Archi tects and Surveyors ( 1 member ) the Incorporated Assoc at ion of Archi tects and Surveyors ( 1 member ) and S. . . 1 memebr ) . number of other organi sati ons nominate a member , but not on a numerical basi s . Archi tects not bel ongi ng to any of these organsi ati ons are the so-cal l ed ' unattached - for next year thei r number has grown to 6610 (the numbers grow ei ther through newl y-qual i f i ed archi tect E not joi ni ng any of the consti tuent bodi es , or through the resi gnat i on of ol der ones) wi th 14 representati ves on Counci l . Si nce they represent about one quarter of the professi on , it i s i mportant that there shoul d be , at l east i n thei r consti tuency ' of the 'unattached some understandi ng of what they stand for . It i s al so i mportant that these archi tects exerci se thei r r i ght to vote (often onl y about 20% do so) and , i f they f i nd no cand idates who represent thei r vi ews , that they nominate , i n future years , candi dates who do so. The Act al so set up a Board of Archi tectural Education on which , apart from representati ves of the Counci l , an even wider range of educati onal and other organsi ati ons are represented . These i nc l ude ( as now amended ) most of the School s of archi tecture. Those ' unattached Counc i l l ors and candi datess who have si gned th i s statement are i n no sense an organi sed group . But they do share some common ground which i s set out here for i n for nati on , wi der debate and to encourage greater parti c i pati on i n the el ect i on . ARCIJK IN AND OUT OF THE NEWS Most arch i t ects , beyond paying the necesary annual retenti on fee , have no contact wi th the organi sat i on , no i dea of what I t does , and l i tt l e i nterest i n i t s debates . I n recent months there was short l i ved medi a coverage of a rumpus between the RIBA and ARCUK on what appeared , to 1 most outsiders, to be tri vi al and l egal i sti c issues about the way people had been appointed onto ARCIJK Counci l and i ts Board of Archi tectural Education. Once there was news of an amicable rapprochenen t between the two bodi es , ARCUK once agai n sank i nto i ts customary obl i vi on ! But that rumpus was the t i p of an iceberg whose submerged porti on represents very real di fferences wi thi n ARCIJK on the way i ts rol e i s percei ved . The 'unattached have consi stentl y pressed that i nterpretati on of ARCUK ' s rol e which , as f ar as the Acts al l ow , broaden i ts representati veness , 1 ncrease i t s democratic processes and open to the publ ic i ts debates and i ts reports (e . g . an education ) . Above al l , they have recogni sed that the processes by which bui l di ngs come to be desi gned - whether forfthe s ate , l oca l authori t i es or pri vate devel opers as cl ients - exclude he 95% or so of the popul ati on whi ch (beyond perhaps wni or buying i ts own house) has no direct fi nanci al i nterest i n any bui lding project. These people are commonl y referred to as ' users which def i nes a role where f i nance , desi gn , producti on , ownershi p and management of the bui l di ng stock i . e . al l control of resources - i s excluded . Powerl ess , and di senfranchi sed , thei r i nterests are so i ndi rectl y represented , i f at a l l , that they may be better def i ned as ' sufferers ' of bui ldings rather than ' users . The Communi ty Archi tecture movement , wi th i ts strange al l i ance between Pri nce Charles, the RIBA and some devel opers, has come i nto bei ng as one response to the al i enati on whi ch ' users experience, especi al l y i n housi ng . Whi l st the movement has certai nl y had some l i mi ted successes , on the whol e i ts rhetori c now masks i ts unwi l l i ngness for any real transfer of resources to those who have none. So the tri vi al debates on form and styl e , the conti nui ng aesthet i c , soc i al and techni cal f ai l ures and the cl osed debate i n some School S , continue . Natural l y educati on i s seen by us as a central area of concern i nc l udi ng accepti ng the ful l responsi b i l i tes for recogni sing (through Vi s i t i ng Boards) and , i f necessary , hol di ng , exami nations as l ai d upon ARCIJK by the Act . The current negoti ati ons wi th the RIBA for joi nt Vi s i t i ng Boards are a step i n the di recti on of assuning thi s responsi bi l i ty i nstead of del egati ng i t , Hi th l i ttl e pol i cy control to others. As far as upholding and improving the standards of practice are concerned , we see i t as important that d i sc i pl i n ary powers wi th regard to disgraceful or unprofessi oal conduct should be used , where appropri ate , not onl y wi th regard to professi onal i ntegr i ty , but al so wi th regard to performance. So the ai m of produci ng bui ldi ngs wi th good , or at l east adequate , performance becomes the ul t i mate cr i ter i on . A VIEW OF ARCIJK ' S ROLE It i s cl ear that Par l i ament i ntended , i n 1 9 3 1 , to set up a mechani sm whereby the Statutory control of archi tectural practi ce and educati on shoul d be exerci sed by a group representat i ve of more than merel y the professi on i tsel f by bri ngi ng i n others who represented independent and pub l i c i nt erests . Al though the l i st of such bodies l ooks somewhat quai nt today , the Parl i ament of the day tr i ed , accordi ng to i ts l i ghts , to bring i n the infl uence of other educational bodi es , bui l di ng crafstmen and trade uni ons , the major Government commissioning Departments, and other professions i n the bui l ding i ndustry. In other words the i nf l uence of those who would work wi th arch i tects , comi ssi on them and produce the bui l di ngs they desi gned . I t i s reasonable to suppose that i t was al so intended that the users , at l east of the pub l oc bui l di ng stock , would be represened by the machinery set kip . these i nte f i ons have been l argel y frustrated. Some general objecti ves concerning ARCUK ' s and the professi on ' s i nternal structure fol l ow from Fi rst , that ARCIJK should work towards becomi ng a ful l y democratic body, i n which every archi tect has one vote , for a si ngl e national l i st of archi tect candi dates. Second , that wi thi n i ts own membership , ARCIJK promote such pol ic i es w i ll i nc ease communication between archi tects and the Counci l . And thi rd that ARCUK O use -every avai l abl e means to create equal opportuni ti es wi thi n the professi on , i rrespecti ve of race , gender or creed . There al so fal l ow more speci f i c obj ecti ves which rel ate to the posi t ion of archi tects i n the communi ty. The si gnatori es of th i s statement are ' unattacehd ' Counci l members , or candi dates. What fol l ows would probabl y be supported , i n general terms , by most members of Counci l and i ts Board. It i s the emphases and speci f i c detai l s , i f anything , which di sti ngui sh the pol i c i es of these ' unattached from the wider consensus. Speci f i c objecti ves 1 . Comprehensi ve The responsi bi l i t i es of ARCIJK are: . To mai ntai n a regi ster of archi tects . To both recogni se and , i f thought desi rabl e , hol d , exami nati ons i n archi tecture . To make awards to students i n nee d and for research d. To impl ement HM Government ' s obl i gati ons to the European Communi ty i n respect of EC archi tects e . To mai ntai n standards of conduct by d i sc i p l i nary proceedi ngs agai nst regi steredd archi tects whose conduct f al l s beneath an accepted standard set out i n The Standard of Conduct for örch i tects To prosecute those who use the ti t l e Archi tect i l l ega l l y . To carry out these objecti ves and to mai ntai n both prof essi onal and pub l i c cred i b i l i ty i n changing circumstances ARCUK must : . Mai ntain and enhance the standi ng of archi tects as evi denced by the �qual i ty and performance of the bui ldings they design , having due regard to the i nterest of cl i ents , producers and users and . Improve professi onal comwpetence of al l regi stered archi tects throughout thei r careers. 2 . Conduct . Promote the use of the Standard of Conduct and revi ew i t so as to make i t more preci se and more convi nc i ng wi th regard to hi gh standards set by the professi on i n i ts repsonsi b i l i ty to the pub 1 1 c Interpret the Standard of Condust so as to make the performance of bui l di ngs an i mportant cri ter i on c . Review the di sci p l i nary procedures so that , i n sp i te of ARCIJK bei ng judge, jury , prosecutor and court of appeal , they are more independent and seen to be so (un l i ke , for i nstance , the pol i ce compl aints procedures) . de Establ i sh a system , wi thi n the Acts , for carryi ng out the di sc i pl i nary functi ons i n a way more respnosi ve to publ ic assessment e . Make regul ar and publ i c reports i n detai l of those removed from the Regi ster , with both the processes and the reasoni ng behi nd the deci si on f ul l y set out (as , for i nstance , i n the Tines Lan Rep or ts ) . 3 . Education . Organi se and lobby for greater publ i c funds and resources for archi tectural educati on , and defend resources agai nst cuts (ARCIJK was, notabl y , the onl y professi onal body to defend vigorousl y the School s agai nst the cuts proposed by the E sher Report ) . Respond to al l government and other proposal s that would affect archi tectual educati on opposing those which woul d reduce standards , supporti ng tbose that would i ncrease i t . I n i t i ate proposal s of i ts own , part i cul ar l y having regard to the publ i c i nterest , which woul d i mprove educati onal standards . Create a centre of i nformati on and advi ce for a l l seeki ng to enter the school s as students or teachers and for the professi on . Wove towards an accred i tati on system that has the conf i dence of the publ i c , the professi on and the School s i ncl udi ng thei r students Reorgani se the vi si t i ng board system so that ARCUE , the prof ess 1 on , non-professi onal i nterests and students have adequate and agreed rol es g . Make al l vi si ti ng board reports pub l i c . 5 . Awards . Make awards to archi tectural students i n need , and ensure max 1 mum pub l i c i ty for the avai l ab i l i ty of thi s help . Provi de schol arhsi ps to enabl e excepti onal students to compl ete thei r courses wi th d i st i nct i on . Make awards for research to: . Undertake research projects Assi st the organi sation of research Publ i sh research resul ts having regard not onl y to the normal cr i ter i a of schol arshi p and rel evance , but al so to advancing professi onal and bui l di ng performance. A part of the funds must therefoe be devoted to advancing CPD. 6 . Conti nui g professi onal devel opmeht . Encourage and promote CPD for the whole professi on . Support the development of a regi onal CPD system . Appoi nt , or support the appoi ntment of , a nat i onal CPD co-ordi nator . Encourage and gupport the appointment of CPD c cordi nators i n the reg i ons and i n the School s , i n al l these acti vi t i es keepi ng , once agai n , the publ i c i nterest i n the forefront . 7 . European Community . Pub l i c i se the opportuni ti es i n the EC for both IJK and EC archi tects . Prepare the professi on f or the un i f i ed market proposed f or 1992 . Encourage the exchange of i nf ormati on between al l EC arh i tects on both practi ce and educati on . Create , or support the creati on of , a centre of i nformat i on on the EC for both UK archi tects wishi ng to work i n the EC and for those EC archi tects wishi ng to work i n the UK. 8 . Fi nance a . Col l ect and provi de adequate funds to achi eve these objecti ves , revi ew the retent i on fee annual l y and , i f necessary , i ncrease i t . b, Al l ocate adequate funds for education , awards and CPD. If necessary , move towards the ori gi nal 50% of the retenti on fee envisaged i n the 1931 Act . THIS ELECTION I f you agree wi th the tenor of th i s statement , and are an 'unattached archi tect , use your vote for the candi dates who commi t themsel ves to pol i c i es along these l i nes . It i s important for the total vote to i ncrease , and for those elected to f eel conf i dent that they real l y represent some si gn i f i cant proportion of opi ni on . If you can f i nd no candi dates who seem to represent your vi ews , organi se to have some nomi nated , at l east i n ti me for next year ' s el ecti on , and make sure that the i ssues you care about are debated both nati onal l y and l ocal l y . Si gnatures : Creator An entity primarily responsible for making the resource T Markus Source A related resource from which the described resource is derived JA Date A point or period of time associated with an event in the lifecycle of the resource Undated https://nam.maydayrooms.org/files/original/869a8582a06679dd1eb79b6595ef840f.pdf 1741e738c9abbb6fbe846b1798adc47e Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Professional Issues Description An account of the resource A cohort of NAM members became engaged with the professional registration body, standing as elected councillors on the Architects Registration Council and its various committees. Hitherto entirely dominated by the RIBA bloc, the Council began to yield to a new dynamic through NAM's involvement, enabling fresh perspectives on such issues as mandatory fee scales, greater lay representation on the body, ethically-based standards of professional conduct, etc. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Letter to JA with revised version of "ARCUK 'Unattached Architects" for signature Subject The topic of the resource Letter to JA with revised version of "ARCUK 'Unattached Architects" for signature Description An account of the resource Mr John Al l an , Avant i Archi tects , 39-41 Omnibus Workspace, North Road , LONDON N7 9DP. 13th January 1988 Dear John , Here i g a revi sed version of the ARCIJK pi ece. I hope the attempt to combi ne al l the comments won ' t outrage anyone too much , I t m sti l l trying to get Norman ' s agreement to si gn , I have sent a copy to Mi ke Jenks to ask him to deal with the AJ , 1 have , i n the meantime, agreed with Paul Finch of BD that ei ther you or Sheelagh McManus and I wi l l be interviewed i n London on January 18th for an i ntervi ew-type art i c l e to be publ i shed by them before the end of January. I t ve l ef t message for you about whether you ' l l feel able to sign the statement and next Monday ' s i nterview. Wi th good wi shes , Yours sincerel y , (Professor ) Thomas A, Markus ARCIJK 'UNATTACHED ' ARCHITECTS WHO ARE THEY? Duri ng ear l y February the el ecti on of t una t t ached ' Counci l lors for next year ' s Counci l of the Archi tects ' Registration Counci l of the United Kingdom (ARCIJK) wi l l take pl ace. In these el ecti ons a group of candidates present themselves to represent those architects on the Regi ster who do not belong to any of the consti tuent bodi es of ARCIJK. The const i tuent bodi es have the ri ght , under the 1931 Arch itects ' Registration Act , to nominate members to Counci l di rect , on the basis of one member for every 500 (or porti on of 500) of thei r own membership and the most important of these , numerical ly , i s the RIBA wi th 42 members for next year . But al so l i sted are such bodi es as the Arc-hi tectural Assoc at i cn (2 members) E he Facul ty of Architects and Surveyors ( 1 member) , the Incorporated Assoc at i on of Archi tects and Surveyors ( 1 member) and the STAMP section of UCATT. A number of other organi sat ions nomi nate members , but not an a numerical basi s . Archi tects not belonging to any of these consti tuent bodies are the so-cal l ed 'unattached - and thi s year their number has grown to 6610 (the number grows ei ther through newl y-qual ified archi tects not joi ni ng any of these bodies , or through the resi gnation of ol der ones) gi vi ng 14 representati ves on Counci l . Since they represent about one quarter of the professi on , i t i s i mportant that there should be , at l east i n the 'consti tuency ' of the ' unattached ' some understanding of what they stand f or . It i s al so i mportant that these archi tects exerci se thei r ri ght to vote (often onl y about 20% do so) and , if they f ind no candi dates who represent thei r vi ews , that they nominate, i n future years , candi dates who do. The Act al so set up a Board of Archi tectural Education on which , apart from representati ves of the Counci l , an even wi der range of educati onal and other organi zat i ons are represented . These incl ude most of the School s of Archi tecture . Those current or recent ' unattached ' Counci l l ors and candi dates who have si gned thi s statement are only in a l i mi ted sense an organi sed group. But they do share some common ground which i s set out here for informat i on i Wi der debate and to encourage greater parti ci pati on in the el ecti on . ARCUK. IN AND OUT OF THE NEWS Most archi tects , beyond payi ng the necessary annual retenti on fee , have no contact wi th ARCUK, l i ttl e i dea af what it does , and no i nterest i n i ts debates. In recent months there WEIS short l i ved media coverage of a r l.tmpus between the RIRA and ARCIJK on what appeared , to most outsi ders , to be trivi al and l egal i sti c i ssues about the way people had been appointed onto ARCCIK 's Board of Archi tectural Educati on . Once there was news of an ami cable rapprochemen t 1 between the two bodi es , ARCIJK once agai n sank i nto i ts c us tomary obl i vi on ! But that rumpus was the t i p of an i ceberg the submerged port i on of which represents very real di ff erences wi thi n ARCIJK on the way i ts rol e i s percei ved . The 'unattached have consi stentl y pressed that i nterpretati on of ARCIJK ' s rol e which , wi thi n the Act , and i ts l ater Amending Act % broadens i ts representativeness , i ncreases i ts democrati c processes and opens to the publ i c i ts debates and i ts reports. they have recogni ged that the processes by which bui l di ngs come to be desi gned whether for the state , l oc al authori ti es or pri vate devel opers as c l i ents exclude the 95% or so of the popul ati on whi ch (beyond perhaps owni ng or buying i ts own house) has no di rect f i nanc i al i nterest i n any bui l di ng project . These people are commonly referred to as ' users whi ch def i nes a r ol e where f i nance , desi gn , producti on , ownershi p and management of the bui l di ng stock - i . e. al l control of resources i s excl uded . Power l ess , and di senfranchi sed , thei r i nterests are SQ i nd i rect l y represented , i f at that they may be better def i ned suf f erers ' of bui l di ngs rather than users . Archi tects can work , be bel i eve , i n ways where thei r professi onal sk i l l s are harnessed to a real transfer of resources. Natural l y educati on i s al so seen by us as a central area of concern part i cul ar l y acceptance of f ul l responsi b i l i t y f ar recogni si ng courses and , i f necessary , hol di ng exami nations as descr i bed i n the Act . The current negoti at i ons wi th the RIBA for joi nt Vi si t i ng Boards are a step i n the di rect i on of assumi ng thi s responsi b i l i ty i nstead Q f del egati ng i t , wi th l i ttl e pol i cy control , to the R IBA . As far as upholding and improving the standards of practi ce are concerned , we E ee i t as i mportant that di sc i pl i nary powers wi th regard to di sgraceful or unprof essi onal conduct should not onl y focus on the personal and professi onnal i ntegr i ty af ar chi tec ts , but al so on the performance af thei r bui l d i ngs . A VIEW OF ARCIJK. ' S ROLE It i s cl ear that Parl i ament i ntended , i n 1931 , to set LIP a mechani sm whereby the statutory control of archi tectural pract i ce and education should be exerc i sed by a group representati ve of more than merel y the prof essi on i t se l f through the involvement of independent and pub l i c i nterests . Al though the l i st of such bodi es l ooks somewhat quaint today , the Parl i ament: of the day tr i ed , accorcii ng to i ts l i ghts , bri ng i n the i nf l uence of other educati onal bodi es , bui l di ng crafstmen (women?) and trade uni ons , the ma jar Government commi ssioning Departments , and other prof essi ons i n the bui l di ng i ndustry i n other words the i nf l uence of those who woul d work with arch i tects , commi ssion them and produce the bui l di ngs they desi gned . Users ! at l east af the pub l i c bui l di ng stock , were al so represented by the machi nery set Ltp n It shoul d be recogni sed that these i ntenti ons have been l argel y f rustrated . However , some object ives concerning ARCIJK 's and the prof essi on ' s i nternal Etructutr e can be el i c i ted from that recogn i t i on . F i r st , that ARCL!K should work. t awards becami ng a ful l y democrati c body , the archi tect Counc i l l ors bei ng el ected from a si ngl e nat i onal l i st of archi tect candi dates . Second , that wi thi n i ts own membership , ARCIJK promote such pol i c i es as wi l l i ncrease communication between archi tects and the Counci l . And thi rd that ARCIJK use every avai l abl e means to create equal opportuni ti es wi thi n the prof essi on , i rrespecti ve of race or gender . There al so fol l ow some objecti ves whi ch rel ate to the posi ti on of architects i n the communi ty. The si gnatori es of th i s Etatement are recent or current ' unattached ' Counci l members , or candi dates . What fol l ows would probabl y be supported , i n general terms , by most members of Counc i l and i ts Board . It i s the emphases and spec i f i c detai l s which di stingui sh the pol i c i es of these ' Lin attached ' from the wi der consensus. Speci f i c objecti ves 1 . Comprehensi ve a . To mai ntai n a req i 5ter of archi t ect 5 1 0 d war 10 d i ll r 1.1 r l. h e . To i n t. Ai n n (l (I c; of co d u r t h y d •i c; c i p l i n ary p IV oc rl aga i nst archi tect 5 whose conduct f a l l 5 beneath that % et 0 1.1 t i n the The S t a rt d ard C. (.) Ti du c t To prosecute those who U se the t i tl e Archi tect i l l egal l y. To carry these duti es and to mai ntai n both professi onal and pub l ic cred i b i l i t y i n changi ng ci rcumstances AR' CLi \:.•• must : Mai ntai n and enhance the standi ng of archi tects as evi denced by the qual i ty and performance of the bui l di ngs they desi gn , havi ng due regard to the i nterest of c l i ents , producers and users and h . Improve the prof essi onal competence of al l regi stered architects throughout thei r careers. 2 . Conduct . a. Promote the use of The Standard c.) f Cori duct and review i t EO ag to make i t more preci se and more convi nci ng wi th regard to hi gh standards set by the professi on i n i ts r esponsi bi l i ty to the publ i c . Interpret The Standard of Cor:duct so as to make the performance of bui l di ngs a fundamental cr i ter i on . Establ i sh a system , wi thi n the Acts , for carryi ng out the d i sci p l i nary functi ons i n a way more accesi bl e and responsive to publ i c assessment . Make regul ar and publ i c reports i n detai l of those removed from the Regi ster , wi th both the processes and the reasoning behi nd the dec i si on ful l y get out 3 . Educati on . Organi se and lobby for greater publ i c funds and resources for archi tectural educati on , and defend resources agai nst cuts (ARCIJK was, notabl y , the on l y professi onal body to defend vi gorousl y the the cuts prapcsed by the E sher Report ) , Respond to al l government and other proposal s that would aff ect archi tectual educati on opposing those which woul d reduce standards , supporti ng tbose whi ch would i ncrease them . In accordance with i ts dut i es undere the Acts , i ni ti ate proposal s , part i cul ar l y havi ng regard to the pub l i c i nterest , which would improve educati onal standards . Create a centre of i nformati on and advice for al l seeki ng to enter the School s and f ar the professi on e. Wove towards an accredi tati on system that has the conf i dence of the pub l i c , the professi on and the School s i ncl ud i ng thei r students f . Reorgan i ze the Vi si t i ng Board system so that ARCUK , the professi on , non-prof essi onal i nterests and students have adequate and agreed rol es Make al l Vi si ti ng Board reports publ i c . Awards a. Ensure that the avai l b i l i ty of awards to archi tectural Etudents i n need rec i ves the max imum pub l i c i ty . Encourage excepti onal l y capable students by the provi si on of schol arshi ps to enabl e them to compl ete thei r courses with disti ncti on . , Make awards for research to: . Linder take research projects Assi st the organi sat i on of research n Publ i sh research resul ts havi ng regard not onl y to the normal cr i ter i a of schol arshi p and rel evance , but al so to advanci ng professi onal and bui l di ng 4 performance, A part of the funds must therefore be devoted to advancing CPD. 6 . Conti nui ng professi onal development (CPD) . Encourage and promote CPD for the whol e prof essi on . Support the devel opment of a regi onal CPD system . Appoi nt , or support the appoi ntment of , a nat i onal CPD co-ord i nator . Encourage and E up port the appointment of CPD coord i nators i n the reg i ons and i n the School s , i n al l these acti vi ti es keepi ng the pub l i c i nterest i n the f orefront . 7 . European Communi ty . Publ i c i se the opportuni ti es i n the EC for both UK and EC archi tects . Prepare the professi on for the uni f i ed market proposed for 1992 . Encourage the exchange of i nformat i on between al l EC at-hi tects on both practi ce and educati on . Create , or support the creati on of , a centre of i nformati on on the EC f or 1-1 K archi tects wi shing to work i n the EC and for EC archi tects wi shi ng to work i n the 1-1K . 8 . Fi nance a. Col l ect and provi de adequate f Ltnds to achi eve the=e obj ecti ves , revi ewi ng the retenti on f ee annual l y and i ncreasing i t i n l i ne wi th ARCIJK 's devel opi ng rol e b . Al l ocate adequate funds f or educati on , awards and CPD. THIS ELECTION If you agree wi th the tenor of thi s statement , and are an unattached arch i tect , use your vote for the candi dates who commit themselves to pol i ci es al ong these l i nes. It i s i mportant for the total vote to i ncrease , and for those el ected to feel conf i dent that they real l y represent some si gn i f i cant proport i on of opi ni on . If you can f i nd no candi dates who seem to represent your vi ews , arg an i se to have some nomi nated , at l east i n ti me for next year ' s el ecti on , and make sure that the i ssues you tare about are debated both nat i onal l y and l ocal .l y . Creator An entity primarily responsible for making the resource T Markus Source A related resource from which the described resource is derived JA Date A point or period of time associated with an event in the lifecycle of the resource 13.1.88 https://nam.maydayrooms.org/files/original/f8a629a956cb8330fd4068debf64f03c.pdf 3781cff1fb9f7ec8b8b2ee0dd2d3b8c4 Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Professional Issues Description An account of the resource A cohort of NAM members became engaged with the professional registration body, standing as elected councillors on the Architects Registration Council and its various committees. Hitherto entirely dominated by the RIBA bloc, the Council began to yield to a new dynamic through NAM's involvement, enabling fresh perspectives on such issues as mandatory fee scales, greater lay representation on the body, ethically-based standards of professional conduct, etc. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Unattached Arguments Subject The topic of the resource Article in Building Design Description An account of the resource before one was oneself in the position being a boss.” When Gradidge decidedtoset list. The RIBA spends its entire uponhisown,RIBArulesfortimesuggeit’satmiononpogly, welcoming recalcitrinatnottshe and that every architect is a fold were stricter than they are member. It does its best to today. ‘“‘They said, ‘Oh yes, we’d be delighted to have you, as long as you pay half of your entire back subscription,’ which would have added up to thous- ands of pounds! I don’t know whether or not they still have that requirement. But anyhow, that totally put meoff them for calls the Rotary Club factor: good.” Belief Many principals join because they believe that the Clients’ Advisory Service will get them work. Allan, a director in the I've been asked to give a talk firm Avanti Architects, isunim- about ‘‘Unattached”’ issues, pressed. ‘Having been part ofa where if you were unattached practice that was part of the you almost couldn’t drink in the CAS, I’m not aware of its ever same bar as people who were in having procured any work, or the RIBA.” that it was particularly active on Allan said that one of those the practice’s behalf. As far as things he has tried particularly we are concerned, the only to tackle has been the assump- reliable way of getting work is tion that non-members of the through the conscientiousness RIBA are somehow less quali- of your service and the quality of fied. ‘‘Quite a number of dis- your proposals. We are in the criminatory job advertisements RIBA directory, and I don’t have appeared for years in the think we’ve ever had any jobs architectural press, often put through that.’”? After a mom- out by public sector offices, ent’s thought, he qualified his stateme“Inthi:nk we were once of clean enor well as cut saves INFERIOR WOOD PRESERVATIVES CAN LET YOU DOWN BADLY.. The X Factor range will significantly outlast conven- Accidental chipping wil never expose 4 different asked to fix up a gay bar on the Ball’s Pond Road.” Gradidge seemed similarly suggest this on every occasion. And of course it’s not true. The general public is deeply misled over this matter.” Perhaps of more practical effect for many than either the List of Members or the Clients’ Advisory Service is what Allan ned todecorat Institutions vene the Standard of Conduct.’ But now that the unattached were not required to observe the sceptical. ‘‘Well I suppose it’s RIBA code, didn’t that mean jobs for the boys. If the RIBA that a member was now obliged under the Arcuk code, iti conceivable that you co penalised for incompeten tice, whereas that is not c by the RIBA Code. Fi latter, you’re only oblis carry out your duties fait In the case of Arcuk, obliged to carry ther faithfully and conscientio. The way Arcuk statistics are held make it difficult to make accurate observations about the employment status of the una- ttached. But it’s probably true that most of them are salaried. Despite —or perhaps because of — the efforts of the salaried Architects Group, the idea that the RIBA isstillaclubfor *‘boss architects” seems hard to shift. Even so, many hold off from coming out too strongly against the institute because they look forward to being bosses them- selves one day. To do otherwise would be about as logical as a group of militant grubs pro- testingagainstbeetles.becauseoneisn’tonthatbloody|Asaaeeeea —| t:arender you represented 100 per cent of to offer a higher standard of architects then it would be service? Not in Allan’s view. perfectly proper, because they could hand out the jobs to the right person. But in many cases the right architect isjust the sort of person who wouldn’t be a done so, decide for yourself member of the RIBA.” whether the Arcuk Standard of In his view, the institute Conduct is or is not more already enjoys an unfair ad- demanding than the RIBA vantage, thanks to a long- Code.” According to Allan, a standing misunderstanding am- “performance specification” ongst the public: “It’s always narked me that people still think that I’m not really an architect, approach is likely to be more effective than the RIBA’s com- plex set of rules. ‘‘For example “These institutions /‘at where the marketplace is a needing only th water, “Out in the real backwoodlands perhapsa little bit more crude than it is in London and the South-east, it does seem to bea lot more significant than it does here. Ihave been to places where incidentally. Nowsuch practices may be considered to contra- white finish is re ‘< one-coat technique Demanding “Read the code and having Perhaps surprisingly, A philosophical about the ence ofthe institute: “Alls vocational market secto have professional associ: That’s more or less inev and I don’t see much px simply mouthing off agai RIBA for the sakeof it. guesswork that c variations Incol consistency. time-saving co ate to decora te - late rd n an immaculate even when 4 quired. his ® here 1snO . arating. risk of layers SERS" ARGUMENTS arend isacoloured|render, texxture,, aand eatherprotection alinon p inonesingleswiftoperation,Iti" DYnt compatiblewithalnormalreners vat ‘cht ingre- | colour, either, e aeonSee oe Cullarend|isasi Ted in the same bag, | colour nig through. Neola e addition 3 appili Specification is sir fied, too, because 4 S| product specificatior now sufficient to COV! rendering needs — int as well as external. Blue Circle’s cor research and develor and itsunrivalled e ence of thebuilding try are enabling t plasterers to creat better finishes In ab« the normal tme eliminating the tra: 1-2 weeks’ delay fo! and the need for d ing. The key: ‘0! mously on time .aS ting out the an cause our and Further mes from not needing to return at a also means that t | |Name |address | eR Rae [- Categories Our High Performance _ weather sinpping on designed for the alesman. IF you’re an architect, the chances are that you’re a member of the RIBA. But have you ever thought seriously about why you joined? Did you do it as a gesture of solidarity with the profession? Did you join as soon as you could after you qualified, in celebration of your newly- attained status? Did you join it for the library, for the bar, or perhaps for the half-price lec- ture tickets? Or were you terror- ised into believing, as some still do, that if you wanted to join later, you'd be forced to pay half of all your back subscriptions since you qualified? Whatever the reasons, the vast majority of architects do join. In 1985, RIBA_ member- ship numbered 20,462, out of a total of 28,044 UK-registered architects — that’s 73 per cent. Most of the remainder, whe- ther they like it or not, are represented in Arcuk by the Unattached group. Compared with the fully-funded opera- tions of the institute, elected councillor John Allan and his colleagues have an uphill strug- gle. Nobody paysasubscription to the Unattached — a case of representation without taxa- tion. _ SpecifyAstolat High performance windows designed for Britain’s climate {BEaerT 5-9 OCTOBER 1986 EARLS COURT, LONDON Make space inyour diary for Building 86—it could be the most important day's work you do this year. Return the coupon for your advance registration details. Please send me advance registration cards and exhibition details 1\ } ae u The Exhibition for these changing times. Return to Building 86, Advance Registration, 11 Manchester Square London W1M SAB ance and inertia that suits the institute fine.” Allan has been an elected Arcuk Councillor for 10 years. “Until we became involved Arcuk had become more or less taken over as a sort of RIBA subcontractor. For example, until four years ago Arcuk gave statutory status to the RIBA Code. There’s no earthly reason why it should. And there’s no reason why people who are not members of the RIBA should be obliged because they're regist- ered under Arcuk to observe the rules of an institute to which they don’t belong. “More recently, under un- typically non-partisan chair- manship, Arcuk has correctly distinguished its role from that of the RIBA in the matter of education and, in so doing, made a valuable contribution towards the maintenance of standards. This independent stance would have been incon- ceivable 10 years ago; and I should like to think that the activity of the Unattached in recent years has been a con- tributory factor in this process of emancipation. What hasto be appreciated isthat becauseofits statutory responsibilities, Ar- cuk has a higher role than to serve any constituent profes- sional interest.” Roderick Gradidge, by con- trast, is the most isolated of conscientious objectors: in his own words “totally disenfran- chised ...not even attached to the Unattached”. The serious- ness with which he views the matter is markedly less than Allan’s; and his response to my question why he wasn’t a member was hearty laughter. “When I left the AA it didn’t strike me that it was going to serve a very useful purpose for me, and ‘having qualified, I didn’t bother to join. I don’t particularly like the RIBA, and as you know Ithinkit wasatthat time very mucha bosses’ union. That was in those happy days Allan cites three categories of Unattached — the conscient- ious objectors, those who don’t need to join a professional association because their boss, partner or spouse is a member, and the apathetic. Can one articulate apathy? Are there in any case really all those seasoned professionals out there who, though assiduous in pursuit of their clients’ interest, just couldn’t care less when it comes to professional matters? Italked separately to Allan, principal in an architec- tural co-operative and, by contrast, Roderick Gradidge, noted eccentric and one-man band. “T do believe that many newly qualified students simply join the RIBA out of a conditioned reflex,” says Allan, ‘assuming that in some way or other you have to, to practise as an architect. The last moment to deal with this misinformation Is of course Part I] — but then most of those running the professional practice courses are themselves RIBA members who may not really understand the position anyway, and are therefore almost bound to present the professional con- stitution from an RIBA view- point. It’s a mixture of ignor- e@motives of those who don't? ferent examples. Gradidge’s essential objec- tion was more personal. ‘The trouble with the RIBA isthatit’s impossible to move them by resoirdgoinnganiythninggelse, They’re such a solid lump of professional nonentities. ronthe vene the Standard of Conduct.’ But now that the unattached were not required to observe the RIBA code, didn’t that mean that a member was now obliged to offer a higher standard of service? Not in Allan’s view. Demanding “Read the code and having done so, decide for yourself whether the Arcuk Standard of Conduct is or is not more demanding than the RIBA Code.” According to Allan, a “performance specification”’ approach is likely to be more effective than the RIBA’s com- plex set of rules. “‘For example 7 under the Arcuk code, itisquite conceivable that you could be penalised for incompetent prac- Roderick Gradidge Architect. tice, whereas that is not covered Everyone from Christopher by the RIBA Code. For the Wren to Edwin Lutyens has latter, you’re only obliged to tried to call themselves Archi- carry Out your duties faithfully. tect. Nobody I know who’s of In the case of Arcuk, you're any quality really is tryingtocall obliged to carry them out himself ARIBA” — or chart- faithfully and conscientiously.” ered architect?, I ventured — Independent minds: Roderick Grad idge and Edwin Lutyens. ‘Ait in one single swift Decorative Projection Render togE A t: arender need ion aal weather protectionop k ea Perhaps surprisingly, Allan is “or chartered architect, a re- philosophical about the exist- volting expression! enceof theinsti‘tAlultsoerts:of “T work as an architect, and vocational market sectors will I’m much more interested in have professional associations. being an architect than all this That’s more or less inevitable, damn nonsense about profes- and I don’t see much point in sionalism . . . anyhow, I’m simply mouthing off against the Master Elect of the Art Work- RIBA for the sakeof it. ers’ Guild. That’s much more ‘“These institutions exist. important!” you decorate. STORE | uy ‘er aeprpre to creale ever because the same way ternal - —) BUILDING DESIGN, September 12, 1986 25 They’re probably 19th century cultural products, but there they are. And people who want to join themcan join them. What I think is not acceptable is if statutory bodies such as Arcuk, which were set up with a fairly clear brief from Parliament to achieve certain public interest objectives are, if you like, hijacked by the RIBA —either benignly or otherwise — to promote RIBA policy.” “As you know, I call myself NEW RENDER TECHNOLOGY Blue Circle : Le PRECISION PRE-MIXED RENDER, COLOUR, TEXTURE, WEATHER PROTECTION w Thevery finest traditional ingredients, CULLASENID | } render, texture, and — Opel colour one.Projection-applied compatible with alnorma colour, either, Cullarend 1s colour right the h... Specification issimp fied, too, because a single product specification now sufficient to cover a rendering needs ~ 1n as well as external. research and development and itsunrivalled experi: ence of the building indus- are enabling today S$ eration, it1sfully |render substrates. Blue Circle's constant To have al the right ingre- dients accurately Pre- mixed in the same bag. needing only the adaition of clean water. saves enormously on wume as well as cutting out the guesswork that can apn variations in colour an consistency. Further time-saving comes from not needing to return at a later date to decorate even when an immaculate WA white fimish is required. 7 precision-mixed in a 40kg bag. m No more guesswork. @ No risk of colour variation. w The plasterer simply adds clean water, mixes, and applies by Projection in one continuous operation from stad to finish, texturing as required. = Completion time: less than 48 hours (not 1-2 weeks, as with ordinary render and decoration). m No further decoration required — even to obtain an immaculate white finish! w No risk of layer separation or of surface Gamage revealing 4 different Creator An entity primarily responsible for making the resource T Ostler Source A related resource from which the described resource is derived JA Date A point or period of time associated with an event in the lifecycle of the resource 12.9.86 https://nam.maydayrooms.org/files/original/b4ead56ad1e9ea831b503cb1bf992cf6.pdf 6e1982906eb25895a8f975e3847c9e50 Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource Trade Unions and Architecture Description An account of the resource Themes included action on asbestos and Health &amp; Safety, and involvement with Direct Labour Organisations and Building Unions. Following comparative research of possible options, NAM encouraged unionisation of building design staffs within the private sector, negotiating the establishment of a dedicated section within TASS. Though recruitment was modest the campaign identified many of the issues around terms of employment and industrial relations that underpin the processes of architectural production. Dublin Core The Dublin Core metadata element set is common to all Omeka records, including items, files, and collections. For more information see, http://dublincore.org/documents/dces/. Title A name given to the resource TASS News & Journal Subject The topic of the resource TASS Newspaper Description An account of the resource “tas Low wage |TASS policy must end JANUARY 1978 news & journal I would like to take this opportunity to wish all members and their families a happy and prosperous a Low wages have not helped our economic position; they have made matters worse. The demand for goods and services has been kept low by depressed wages. The result — unemployment. Today there are 1% million without jobs. That leads to a shortage of money and that means that goods lie unsold in factories, warehouses and shops. Redundancy notices soon follow. Not only do low wages cause unemployment. Wage restraint has failed utterly to reverse the dis- astrously low level of investment in British industry. The argument that incomes had to be restrained to permit resources to be diverted to modernise British industry has been exposed as the sham it always was. A recent table in the Economist showed that between 1955 and 1975 Britain had the lowest level of in- vestment of the leading tenWest ¢ weoplel bts tak 7) plens of Levande) Hxecutive Mike E urnblaert : ~ num of clusion w!hich“emerges from any comparisonbetweenwagesand Sets salaries in Britain and other ad- vanced industrial countries in Europe. le Du iS a col gAUEW (TASS) SALARY CENSUS ffl -J in the Cars Division. So far as TASS members are concerned it is ludicrous to European countries. If anything investment was even lower during the social contract. So what has happened to those wage increases we have sacrificed? If the benefits haven't gone into British industry where have they gone? They've gone into the pockets of the employers in increased profits. And they've been frittered awa, in overseas investment, helping overseas competitors and adding to Britain's dole queues. Expansion This disastrous farce should be ended. There must be new policietso expand and modernise British in- dustry. The revenue from North Sea oil may be our last chance. THE TASS SALARY membershi soared a 1978, would also like to thank all active members, including the Executive ITISTEMPTING totreatasajoke recentspeechesfromseveralTHERATEOFGROWTHofwhichleadsustobelievethatployedbyTASSforthe Ministers indicating that wage membership of TASS during we can achieve not only our unstinting work they have increases should be kept to 5 per 1977 was greater than the aim of a quarter of a million put into the Section in 1977. cent in the next phase. sum total growth of all the members by 1980, but an other white collar unions in interim target of 200,000 by But kite flying is intended to engineering put together. Our this year's annual conference After thanking you all could I now call on you for more effort in building the Section? Our membership ix now 182,000. I have one done, Help me to achieve it ambition as President and Help yourselves by naking a that is to preside over next strong and effective Section evoke a response, And we shall be rate of recruitment last year failing in our duty to our members if was ten times higher than it we don't make clear our absolute was before 1971 hostility to such a proposal. TASS is now the foremost in May There are still 40,000 qualified engineers who don't yet belong to a union. There The trade union movement has for white collar union in aero- are about 100,000 year's RC Conference with even stronger and more too long acquiesced in a policy of space and shipbuilding. The unorganised managers in delegates representing effective holding down living standards — a policy of wage restraint dressed up originally as the social contract. The current limits on incomes have been unilaterally imposed upon us and it is high time the TUC stopped dragging its feet and said so. Cheap labour new publicly-owned bodies in engineering; and hundreds of 200,000 members. It can be BOB MANSFIELD. aerospace and shipbuilding thousands of clerical workers have recognised us as who ought to bein TASS. representing all staff — The four-page centre pull- The policy of low wages is com- pletely m iedie ected. British labour is achievement for TASS. The members that t ir interests JOHN ROWAN, National Industrial Officer, was, as this issue labour. That m: i da.Itisthat ing. AShasSalreadymadeplainitsopposil ‘Leyland sackings figures given in this issue of lie in joining the most effec- went to press, involved in top level talks on the future of TNJ are facts, not tive white collar union in here is no such pretence now. clerical, technical and out in this issue of TNJ is managerial designed to be used as a From a wide range of jobs poster and put up on your across other sectors of the notice board. Its purpose is to engineering industry men and provide facts to our active ‘wil be resisted women have been joining us. members: information for 1977 was a year of solid them to use to rsuade non- eee po NOT FOLO TS Foe Pressewriebeigacerprovidedandmat darashertextadybepenedasappreeca’e 5 (a) Aen you 2traicen oeapprentice7 {R) 01CSpeasewastelengeofarperieneemew Tdeeyou aTASS emer? census form invaluable. It has meant, for CENSUS is the only one example, that TASS has been thinkofsackingswhilstmillionsofpoundsofdesignworkis bei: laced on the continent by Leylands. TASS has reim- ts ban on design work going out of the company, It lifted produced by any trade union in Western Europe. It is the most detailed sunvey, of engin- eering staf wages from any claims. 7 5 cael including even the The more replies we receive, Government. the more effective is the The first requirement is for the trade union movement to refuse any longer to condone low wages whether dressed up as the social contractorenforcedbytheTories The purposeofthecensusisinformationonpage12and rigid money supply policy. Tofight to improve theyeamee and con: emnesmubrer tahtat youerveryworkTplAaScSe for higher wages is to serve the ditions of TASS members. fills in the questionnaire. national interest. ‘The information it produces is able to use the information it ovides in a number of ighly successful Schedule 11 survey. Read the detailed -ommittee, full-time of- ficials and all staff em- its earlier embargo to enablea Government inquiry to establish the facts. The Government has not yet fulfilled its promise to investigate. Toirub salt into the wound, wages paid to do the same work on the continent are four to seven times higher than our members at Leylands are getting and skilled design teams in Britain are being broken up through the Government's low wage policy. The TASS embargo will continue whilst jobs are threatened. These lunatic Leyland policies st be changed Christmas fare— with alittle help friends New Year message from the president Vag BOre . 1Sad Presne mart apprvprabemr wee tenes | ee. | 3Salary Passe wate wis! woahy nmrent esukusive of anyereveme ar Danes ree | : A «Al, =le e a ies ELD -40° Taseweat toy General Council who voted for TUC support for the firemen. from their hat the families of firemen on strike East Anglia divisional president, deliver a Filinyoursalary TASS members all over the country made collections and menerout Sony Christmas. Seen here Ron Borrett, EC (right) and Bill Grant, hamper of goodies for thekids. Ken Gill, TASS General Secretary, was one of those on the coors gees ers onc E upon a time in a demanded mostof itin tax & ‘ < , M on the formative cocmepnatnrya.l SeraSofaetrainedstaf NuffieldPreas,,whichis eee bottleneckp.e Teoaevoeid this, | rheoyuisaend; Brepartienotidng whicfhor ?22,100by 1986. FAsSisconpercngresy|mnfcureindutralTASSgrows sete. [a nquiriesintotheirpay,conditioenasrsandttshe aaa a aera SR UIGER su enjoyed my stay at peenetaraofthefireservi emostrecentwasaf—__ —— “Caplene-Ferne”Cosn: ae 1966 the firemen pave had no les: ° po r t e d by the union. working group under the chairmanshi of Lord Mc- Carthy. tesoughttoevaluatethequalifiedpan s ob in relation to others in the communi Re The fin- ony, 2 valescent 7 actin ae eecomen ete] earings of all adult males, then standing atPer 8.08 a RACISM a ext were maleearningsplus10percenttotakeaccountoft Ver Iae liketorecomraedtothe10per 7perniciousadvertisingby Onegrouppreparesevidenceformocknegotiationsonpalin wypheirchattootkhepGlarcaendlateToltals,tteinnctoinugntefrorbewttherntraniengion-gbeaecnkgroupnrdeparemda.teriaItlwhasd was a most instructive generally agreed that al eralCouncil causeofblod being,shed R.E,HUTCHINSON |on scale 01 R aterhapeyialakGane ane as oetotradeunionac-groupScnlththetopicofwentwrongcouldEatiny Housaholalirems afast¢ne.OE itsprofi Oetatee,hewassnidtobe sa inDecember, coieaaenehe risk of f Eee e mo e A Grimm fairy iene the 1. The wordsblackand pcvoven| mieten starilivedproperty een ee Peres | PipskersUnions axes eb the contestants knew.23 | were unequal tarot wee of skiled of| Special Products; sto of two | arebasicallyinsulan So-called” 9 coe are al ad: ficult son women | extraordinary hoteh- tena, Last seers £16 technicalities of such iene a cae Mfcams|Nationality,ClaseorwHeletderiDnecgemb'ers|terbetom’s, leter Gy"yelthesofbers feaa the village came and made al 5 2 : shoes and || regimentit’s fighting eel[eesteneneesfiaheinsae ee has failed the By turnover, Leyland Asissooftenthecase Sector hasfa wl Srunwicks ee es , bet ord alt aivayswanted.callviteorBhaneforour colourcatalogue Since whendoes neneed | ations!” tos screenbeingsat tworker helpal‘owerpals‘People, seVerylitleo a ye tradeunionist,Mr.Gough, Youaweittoyourself! alma paying taxes Toadandest oducts Division are whictiniy|theapiviaicn's sensefor tee civienita Aveling Barford, Aveli headquarters. fold, enplovee % Peherewasbuoynleyeanonoetlweay thanmachine!Pre e) Sorry” were back ShoemakerOnetohis started,onlythistime employee, “but business is paid taxes on two business For a while redundant workers each. Senacsand’aman Importety.Bayram struction and agricultural car manufacture there contribution to Britain's uipment. And finaly and making 3,000 publicl owned erOnedidquiteNexttheytriedto.un: wel because by under dercut’ each other by PeanedetalDarelrectoranelerlaSRSA poebentneeweber heincreasedhisshareofprofitsuntilShoemaker Wipers,furnitureandfabcicsbyaleadeo ; Bee Which manufactures yearold wiz kid witha "As John’ Rowan, : neapoint | to popularise breast 5 ri Dyers etal = GERARDCOLLIER aN a hikedup the prices so that Meee tinea Hedidn't live aswell as he had hoped because he had to pay the wages of a taxman and dole money orm four redundant employee Moral: Not all airy tales iS in are fairy tales Sequel. For anyone who thinks that extra em- ployment, was achieved in juction of shoe iiS oe oonee there|relyhelped machines, IT have another Once upon a time there to tell members reo rom @ enforced back to work. It’s true FEE eee alenmunitment tofutureim-||IWOULDlitokcoemment|theytakeytheiroptionto annualnereaneecwasdueinoeProducts,bysvi ovements which they wouldn't have got otherwise. || on the background to your this benefit provided by| September 197; |.stding| thatbottle fed ving juttheydesetherirvclaeimdnow reviewofthe ° 7 vilb eos orritten|AWaa leailia een white should never be used Costs more than breastfeeding(cost of mall,equipmentand Campaign TASS is spearheading a |\the . | he todescribe‘pole—they mipawemen tingtothe clakckoftain asmajor r the women matlor i for|threeLeylandDivisions. Hageunioc‘otmumnitieswith Special Products is ear icularlyskilled ae technicaltaff—andthatThatsellitngftofSfacorulidsbe Whisihelwascountingexhauwaedtstiarvoatnion! hisprofitanoficialfrom ShoemakerTwonow|Ifthere'sonething|wilnothaveinmy Gisinprolmasetyings.Alour tohel focralvcaorypatsthroug s | i Teecereonneree:I]Judith! Hunt, “TASS National Women’ eared Siscaliongoer Geemneataa SHateininduastnryalafter CruaniserLelen|CowanChalnwomaniorensordertotoisupplyplant°HivingOff?—industrytheprivate ecientCHARIhereon Marsiand,AssistantGeneralSec:taryofthe 30 COHAR tiitences Pee ee Dept-TASS eisO74)278, pelvonese omewxcalrzmsCant WeacceptBarclaycard,AccessAe Si one'smind?Frespechis! believe Stil i allowed SinieBritain re pyicience and anarchy. todayalthoughsocialists Having.saidthat,1do profiteeringsectorofour donotrelectmyopinions seemtodislitkheisfact believeintreatingviolence society exploiting the Thisisthereasonwhyso Glangewe Conary Csngee Fematong Contact: e or an f = cra cea an Te le tal cae BUYING JEWELLERY? ; oftheUtetntotsithtaed oshavebenrumours 7table,guarantesjob 3 4 tanibiteSticlose. eaePrepareteosw neige|potehofcompaniecsa,ch"illlonwasinvested Sbloan anticipated:economic.|name.“YtincludsetheSteadyex; ey, Se RS wnat wa a Leyland Special Rea : C % hy staiyn O R Y Nh |cesssene |BrySee —‘AS_AMEMBERofofthithe Fy relationshipbeeen ergo Masteringcone viouslyourbrainsareal|mite for1.C.L.mayI Siete are ienportant. Pete nh foe|Base: coloured). Groups cen correct some of the ‘One ribed by the terms| inaccuracies in Mr IN REPLY TO D. Win- sta,er itiesoftravewlil||Firstly, the|1-C-L.|isue,ofcoursewomencan (aealacaitionalcot SeeTanaLRA ofan| jucea worldinwhich|scheme does contain a|makethedecisionwhether "itminorityofcases inthevilageneded.I paytowardstheoficial'sdifferingpeoplesare|guaranteed10percent(12|tobreastfeedornot.But herethemotheris > theunion'spdoelimcoy!crwaacgyes, 2“094u,t,thberenaudmtbhoefr,trqauianlintgy|cTonydliatnidonvse;hiclesScainmmarecltlic AstheDivisionexpands, ailndtuesrtnraitailve economic staf. Trailers; Coventry 50TASSgrows withinit. Policy,racialismandinter- “Materialsforthene Climaxforklttrucks:TASSmembership‘hes st Saidictaprealto r thenumber ofhourstheir employeesworkedand h the number ofshoes nationalpolicy. tiatingexercise ThewholeweekendhadQuizareavailableinowChmaknegsinautoGmeatriscwtrhaincsh-months. visionhas celtaem they produced. Neit broughtclosertogetherin|percentover14months)|deci based on}inpeer ganetiabled|wichieeemekey an|knowledge and ifthat are andthe tanks;and increased7loverd1b)per olivein,ahomogeneous|increaseinturnovoefr10|knowledgeIsbasedupona ape pos pen ec e i vious|ant loctrination, then the cam) sign centinthe fasta a would they agree tocharge make him think it was yDIG years, turnover has| of financial gain, surely it tatenounhtp|resultofintermarriag year,Ineachofthepastbymediamenforthesakewouldnotbenecessary.7 beenexpertlyplanned.The|iromTASSHeadOffice)|missionsforbuses, afederatedstructurebutItmakes boats, trucks and trains lately it has been Sould-aswelworthwhile,Thatwasuntil| LENDIGHT|risenattwithicsreate, istheduty'ofthetradewomenandbabieswil totheShoemakerTwoboughta|>—— ——_—__—_——, |unionmovementtotrytoallbenefitfromtheTUC —‘ineludingBritishRail’sdevelopingmoreand sense igh-speedtrain. mimoargee.ofItsaincdoursptoriaatle WhileSpecialProducts machine, sacked his em ployeeandproducedas many.shoesasShoemaker One.Thisbroughtbothof redress the balance. action onthis subjeacndtI Oneofthemainreasonsaaalltradesunionisttso is an extremely, diverse Aveli rtreollalteidonscentproallilcytihsr.oucgohnDivision,Leyland’smain ; PLEASEallowmetoreplywho ispoliticallyfedicineandsquealwhenthisso-called toJ.P.Gough(November) motivated: it TNJ theygetsomeofitback mt ed working| Briton2Inyaltonin Gute Chane DONTAEAGUE10 milion,“ofwhich£70Productsbacktothesecurityandabigsayfor milion’ were exports rivate sector. yn staf workers, then an expanding public,sector ping : J man’s government in- atackingmycommentson whichcynotseemto,No BythewayIamnot ‘oducedabasicminimum B yay) COUNTS! BotoaRRUproh bel nwekayn vou lhare[||| Soumzienmosion Soreken97trvlewredl hy” y not ; addictedtomytelevision ade.Surelythis,would making,itone:oftbe Bavideo Nee istheonlyanswer.” withviolence(likebirchingworkingclas—ohgawd!fewofmycoleyiescanbe YesIknowthedifferencefootballhooligans)astheseDon't = betweenanM.P.andonepeopdolnoetIliketheiroewnraMsr.GouGgohloitdiesnavbeourtoetiemeaaaaaeaaeRitts| As for the one aboutthe and you and the TNo {anetOionSetS EdinburgaFredericaSt,0.257204 IMETRACO 250,KINGSTREET,LONDON.W.6. = ulisingseit attheschool. D1r2eeReaeinlwdaiynceTeraracae,Resby, TobaccoWorkers’Union, Special ove, alaine SLonemacctlonsiaol and the work- cighthbigest,company Rationalised industry wearetobuilda beginto lokprofitable, ing,industry TASS News & Journal January 1979 TASS News & Journal January 1978 vase was ducin| manufactu: a claiirmeidnghbaym,alasagreatexperience. theefforthadbeenBenth ‘Thefiremenhavebeenmadethescapegoatofthe}|DiTsadmvantaogledinenBoruitgahin’to}PeeaGweTAYLORwilhaverecei, celendal(tbheycausfeor Success.SixtywomenOnSat hil i Secaees Congrespolicyaot]|rememberthesocaled| racial theories’ emanating rone a7 he K Gil supported the firemen on the TUC || and ‘40s whieh were a pointsfromthedivision,|_reslatantcoeinfection ; : AnAUHGe to ehUdaei atendedand.”since"amembeafrNsoo15DirHunt,"TASS"Nations; special effort had been sion joined the women to Women’s Organiser, and shou : selvestothetruthorake Causesextraworkfor newcomers, more than half performance of the Mon- deserved many it WwereeithernewtoTASSorstrousHogiment‘theatretions.‘Theonethingtha|ALTHOUGH BuusH eyearners. mingham Postlast ivity. ‘womenai ave been attributed to and) ‘rose from28.4millionto SSglarly unmoveedbry Toavoidtheeyre‘orwillnowswallowhi:themilkandcleaning “TrainingforBetterJobOnSundhiuman_failin bout2114£14mili”onandthotalkthati | novel approach in ne hereceived re 2ate rs 0 Division almost 14,0. Just over gut the Car Division. He : cigsanddonnfio|eandeeringbate Opporsnibe’Prasie s ructutreu putforwardforacampaign supportit. veling Barford P’RacaE ereTeaceavitfiaectuarer.eiconic scalDirector,fromtheMelton makesalotofindustrial jpecial +Mowbray huntin, tl a Sometimes results in This wi Foley FAS eneyor.and]bMteatyant TCT|Readlined,“Womens Stualmikey =) pcelateryeveneTeaerjon.rentselemployeale|mea ee Withit roles u rr4.0)8 10)on rat ; ngShoemaker‘Twotakingsmalerandsmaller TuBarbicanFurnisCehntirnegwehaveacomprehensiverage aetndesphaltplantwellknownpassionforNationalIndustrial auneMourn staid bnistoL, ne Yaua sales totallin about seling Special : y a S t r e ne st w arri toftheSUHniAonE”. dpartenchadedbeetnhae tfooy ann;gedpi r}|S‘pHeScialProducts tute tsem yes i Sa m g T n D l c t iv isio Barfords The Executive Director But the argument Belton whichproduce a of a ial Products is against hiving of hugeon con David Abell,whotook deeperthanthis.Ley!oaid movers, du: cks, over eh 1976, soon after SpecialProducts is h1igh roadSoaresaa carriedoutatechnology,highvalu tractors, plou; ee seed hatchet jb for Leyland in added aes As een drills and other con- Australia, terminating it can make an important Marahalland 9 ,0 0 m i o l p Profactsche Soc to lor £200 millic bai m e l is stil in tHsalt essan a BYOU HAVE YOUR SAY TrainingirASS women COMPANY PROFILE rica “Two McCarthyReport,uponwhichthefiremen’s saertatitonoryy with,aaal e1 diet needs catered for. Those are pl cio Gonle T~RE Stated inreas'a)gro Seely.Wegaet S e Ss The.varied recreation| originalsatheadoficeforreference. £65.70 for a 48-hour week meant a take home £43perweek. ‘Thefireman'sclaimwasforaverage i ma ae ping the hstandardandcovered|= a1 increases| feding wastocombatthe facilities we re o! eo — ru 0ar ne PN RITES Ty a Leyland cars, trucks and buses are a household name. Not so wel are the multifarious fntoheetes See Leyland Special Products Division: earth movers, self-changing gears and agricultural equipment —ail making up a healthy £160 million sales. ange of responsibilities and skils modern firemen Se Tyme ere a the dried milk manufac mend to any aes byTASS in|turers. requireandthehazardstheyface. feisadisgracethat,this,reasonableclaimwa sonable s fortunate enough to hegoti ;: THE TASS Ni It shi 7" needconvalescence|thatreeformemberswhose}|Ifthesedriedmilk Women'sWeekendShoalfalswhichreabeenlfesloraOndjdeteied orse 0 teIoup Government's pay policy. Itisadisgrace that they did confirmation of both these insuportoft nment’s10% > ae I eased that our General| | from Ge ete inedthe women to Women's Organiser, and 8 : e Page Four unionists has provisions for time of. "This in how the Code sets (¢) Appearing on behalf making bodies. takeadvantage oftheCode by claiming Umeoff from their employers for union ions,trainingand industrial OvatCodofracictebas cation. Code lays down elections. unions like TASS who are ‘on behalf of members on include: matters of grievance or {n) Meetings 0!f the Time off for trade union duties and activities THE CODE of Practice covering time off fot de entitled to demand the new discipline. union's official policy before an (b) Other union meetings such as an which need to be held in that is, any elected ployees. representative, such as a shopsteward,isentitledto Fou can, use the Code to pay to carry out trade negotiate better union duties. These duties The oficial is also en- out your new rights: @ Duties of members outside tribunal. working hours. (f)Explanation about (c)Representing the the role of the union at the union on external bodies A trade union official — workplace to mew em: auch as committees of minimum standards. If reasonable time off with @ Training ®@ Advance notice arrangementswithyourinclude: titledtopaidtimeoffor Membersandoficials Manywelorganised (a) Collective bar- training,toincludeinitialwhorequiretimeofare members have gaining. training on appointment expected to give notice to persuaded their (b) Informing members and further training to management ax far in ICE erstoalowtimeofabout negotiations orcoveradditionaldutiesor‘advanceasisreasonable with pay for educational consultations h new circumstances, ‘They should explain why it ix needed and how much sessions about the union, management @ Union activities time is required. entirely controlled ani (c) Meetings with other These would normally Not for industrial staffed byTASS. i union officials on matters The Code of Practice is rial Include accommodation for meetings, access to Employers are not telephone, notice boards and, where the volume of obliged to grant time off to workjusti jesit,theuseofmemberswhoareengaged office f ties. inindustrialaction, ‘The active participation point of of workers in their union guidance” in encouraging may create special dif- employers and unions to ficulties for some workers. For example the Code highlights the special problems of married statute mig! women face: with and the Code domestic circumstances, “guide”itwillremain¢! and the special com- joint responsibility of municwaotrikoenrssdifficuwlotireksersofermepalcohyers saantd uni eciploved in scattered or atgreoemdetnuhtecsnew provisio1 an important advance i> trade union rights. Strong organisation wil enable Trade union members are entitled to reasonable time of (though not Employers are expected youtomake thebestuseof their em- it.Itisonly members o} necessarily with pay) to to provide reasonable jon facilities to enable o! recognised independent {d) Interview: with id activities. These may ‘ofPractice? 1977, failure,byanemployer,tothereforewillhelptoavoidgov‘emrpnlomyenrst’s,TheinfJeBdreirattisohn some of the ‘oblems IN NOVEMBER, Practice on Time Off for y the statute. The C which might otherwise (sniogwnedCBIa)n and t ic TOAST provisions.Ttpas,ineffeck,Wht theBeasisebySsRee ippe RO came int ef cumstances ts industrialtrainingboards. (a) Voting in union Sreintnonof lechMounotParent B@ Facilities action to carry out their duties. isolated locati reduction of pune Tong ago as 1963 which "In pr in an effective and the statu! statutory provisions. iaiPameret necesarytomet mutually satisfac! manner. Anditis. A Parties) (iat the primis StatstoryprovisionsoftheHighwayCode. betweendifferinginterests Government issupporting situation. The Code esponsibilimutsyt always meintoef aAprile aioeastiesa5)te) definition, a compromise p 0 The Emp! it also an im- the statutory provision for therefore establishes a res set Pomether with the Protection Act. allocated tant development in the time off for training with a Code the statutory the task of oducing the levolvement ye towards the cost of toCodestoACAS.wee sibilitytotheinstitutionsthetrainingcarriedoutby Irish members win increases ACCOUNTANTS at Bord but in their case TASS is na Mona, Eire’s State stil trying to negotiate owned peat factory, hourly payments for received no payment at al overtime. ave a major impact upon their representation on t directly concerned in in- the TUC and_affilia' the rights of 300,000 shop Council of ACAS the TUC dustrial relations. unions. In 1976/77 the grant was £400,000 and for stewards and other trade and the Confederation of ACAS has now produced the current year it is TASShassetitselfatarget:tobuildourmembershipfromitspresent183,00to0aquarter of a million by 1980. Thattargetisnopipedream. Thelastquarterof1977sawaremarkableupsurgeinmembership which brought that 250,000 well within reach. union representatives. British Industry have three Codes; the first £650,000 of which £10,000 An ACAS Code of therefore played a major to Disciplinary is to go towar short Practice does not in itself in achieving a Practice and Procedures courses organised by af- filiated unions. Whatit says create law; itaims to set a cceptable set of general and reasonable Each of the standardagainstwhichthe ‘odesisprecededbythe ° statute can be applied in publication of a con- Collective Bargaining. This specific circumstances. Sultative document and the ither does it strictly careful considerationof al third Code on Time Of is impose any legal the resulting submissions. widely regarded as by far The Code spells out the obligation, but its The final Codemay not the most important in its statutory provisions inan for overtime until they idance must be taken satisfy everybody but it practical implications. an in- will nonetheless joined TASS just over a dustrial tribunal rerceoc!onciled some widely differing interests and How itcame about easily understandable way. Tt then provides examples year ago. Now they have ofthe dutiesforwhich a wontherighttoanannual union official should be lump sum payment of£285 for instance, more than 50 In fact we'll go a step further. We'll set ourselves another stiff target. We believe we can achieve a membership figure of 200,000 bythetimeofourannualconferencethisMay. Ten times bigger There are many grounds for optimism that an all-out effort can achieve this intermediate objective. Year by year over the last si» years our membership has grown at an extraordinary pace. Our zare of growth in 1977 was ten times the rate we achieved before WE NEED A BIG MEMBERSHIP in order to force the em- ployers’ federation to concede a national agreement which is eee inrespectofTASS's importanceanditsspanofmember- ship. At the moment the employ cling hopefully to a picture of a small craft-based union which was long ago overtaken by events. Britain's employers are notoriously conservative (with a small “c”’ of course!) but even they will have to bring themselves face to face with reality. A union with a quarter of a million members is a force to be reckoned with. And a union with 200,000 members is a big step in that direction. Wesellai!leadingbrands. |uswhat you want and we }quote our own fow price { "BEDLINEN-STAINLESS STEL TABLEWARE collar engineering staff than any other union and itsrate of Ww creditand after sales service, to. Just’phone The Code prescribes the conditions which coul “ writeofcalllin. 7 LONDON: 3Hon union is not an end in itself. Tt is the stren; th of organisation which a big membership represents, carbine with the vigorous olicies which are the hallmark of our union, that is fundamental orevery TASS member. strengththeycanrely. So let’s get on with it. Let’s make good use of the impetus we argued the case for tending time off faciliti and the Conservative Government's 1972 to effectively perform his union duties. CR Wedd Rings,Sqnetfingr,Bracelet CharmsChainsandafGeldSrwedery wre Mod an ceePeon 1915)GearStret.Newcastle 1BRANYT CU a ay Cue unions. Not the numbers game influencing the policies of the Government. Our delegates to the Labour Party and the TUC will have more muscle. Our General Secretary, Ken Gill, will have more power behind his position on the General Council of the TUC. of Practice also gave alleviate dificulties. It general support. The draws attention to the particular significance of special problems of the the provisions in the EP small firm and to safety ActandtheTiOmffeCode andtheproduction is not that they move in a problems in continuous It is important to get our campaign for increased membership into focus. We're not just playing the numbers game; being a big knowledge that behind them is a massive organisation onwhose ‘oces plants. An oficial leet 1119ChestermanSt,(ofSouthamptonSt.)Reading necessary, to all the TheCodepointsoutthat already have as the fastest-growing union in engineering. It’s in your hands. You can achieve that target of 200,000 members by May 1978. The union is yours. Build it with con- pullout effectively asyou can inpersuading non-members to}ina JAM:982TyburnRoad, PypeHayes.(21-3734602and021-3827101 radical direction but that they provide statutory support for extending practices, which are now publicly accepted as whenherequirestimeof. KENT:31PickfordLane,Bexleyheath01-3033787/8465, 7BAlienPuce, NeenwemtHeadese 13$3chadSad fidenceandtakeheartinseeingitgrow.Usethisfour-page as healthy and thriving organisation. 598203. ALSO:2coihartTeco companies’)whereunions management ma ised. reasonably wish the time off to be postponed for a Isobeensupportedfor while,forreasonsofsafety many years by agreements or production, but says andhasbenacceptedbythatpartiesshouldtryto CAYSTAL Code of Practice 3 Patanest PrctecActo$0n75, sen 8)(9)toeoreenby ittedpaidtimeof.inlieuofovertime.InthepercentofTASS'sclerical jemaintains that sameperiod,thelumpsum members have een Trade unions have for training of a trade union paid toengineers increased upgraded, gaining in- many years negotiated official should be permitted creases of up to £8 a week, facilities and time of as soon as possible after Supervisors also now back-dated to Septem! election and that further receiveupto£400ayear, 1977, training should be un- dertaken where a steward has special responsibilities or where circumstances change. F are given of facilities which management ‘shoul: StilltheleadHaettornGsaridenfor TOANYMAINLANDADRES themainemployers’reachagreementonsuchcaDRnemonnao organisations and by postponement, Anannouncementtoall journalreaders! No matter what others may claim, TASS organises more white WE NEED ABIG MEMBERSHIP togiveusastrongervoicein Orderingiseasy—justtel provtoiednaebleasteward growthisnowmorethanthesumofgrowthofallothercompetitorshapingthepoliciesofBritain'stradeunionmovementandin And most important of all, all TASS members will have the TASS Nows & Journal January 1978 New rights on time off for union work What isaCode PeterD.Carr,DirectofotrheEnquiryBranchofACAS,explains. the ACAS Draft ae of es the facilities enabled Frage ‘Union Duties and cannot go further than the have developed from Actiwvasiatppiroevedsbystatute,norcanitun- Parliament. It ow to. WE NEED A BIG MEMBERSHIP so that every plant is strongly organised and every office committee can talk to the employer from a position of strength. 200,000 MEMBERS BY MAY 1978. YOU/WE CAN DOIT. : Swas abl 1977 onto the statute confirm that thro out book. this new law Page Six Page Seven Engineers, clerks, shorthand typists, WHICH DIVISIONS have been setting the pace in our steadyBD esstowardsthequarter-milliongoal? their choice. Ata top Si Jevel_ meeting the played Institution's’chief getthetPaitentsgActs its own history had ver been a co! clarifie and extends the of employee in en members’ u: and their ngineers among ure prop Kil, qualifica sibility and e. It has its applies the standards of Chartered excellence to its other sional Code of ee InotherwordsTASSisTHEwhitecollarunjoninengin Thfe leader is undoubtedly Division 15 in Birmingham which has grown by 4,915 since 1971, more than doubling its membership from 4,865 to 9,780. Five other Divisions have doubled their membership since the new boundaries were set six years ago. No. 22, based in Luton, grew by 4,325 and now stands at 8,277; No. 12 (West Midlands) added 3,753 new members |and now has 7,390.No. 9 (Leeds) added 3.661 W to set up an which embers to join a tri union of ublications service iS matched by any other Committee is of very well highly publis 10 produced by TASS engineers for bringing its total to 7,167. No. 1 (Edinburgh) has grown by 3,317 to its present total of 5,603 and No. 6 (Middlesbrough) has grown by 2,076 to a total of 3,919. Liverpool and The Salford-based Division 10 which covers I Manchester deserves a spe jal mention. Although it hasn't quite doubled its merembership since 1971, it has added as many as 4,662, bringing the total to 10,089. The Division held a special celebration in November to mark the enrolment of its 10,000th member. The jobs of clerical workers are diverse and complex and many of them are THE Salford division has just enrolled its 10,000th member. Present at the highly skilled. They are under-estimated celebration of this historic point were members of the other sections of our amalgamated union. Seen here with TASS General Secretary Ken Gill are John Tocher, Engineering Section organiser (right) and Wilf Charles, Construction TASS really fights for women MANY OF TASS's clerical members are women. They have joined because TASS has a reputation as an aggressive union in fighting for women’s rights. Our slogan ‘Men’s Pay for Women’ has a serious intent. It goes much further than the more usual call because it recognises that too many jobs are low paid because they have traditionally been done by women, TASS has a number of successful battles toitscreditinwhichithasbeenableto establish wages for women which would have been paid had men been doing the same jobs. There is no conflict between men and women in our policy. It means better pay and conditions for all employees spheresofactivity.To <— TASS has always bring members the included chartered lest benefits of all the w employment slation, it provides expert knowledge, re- rch cilities TASS’s National Technical Sub-Committee is composed of highly qualified professional engineers. It produces a_ technical publications service which is unique. (whe ssary) skilled and articulate advocates at tribunals and other developed a well-earned legalenquiries. reputation f profound _chang to abandoned its original hich TASS has readil ly emphasis on education, pted. TASS has training, technical e for TASS Managers need a union. Too many employers take advantage of their loyalty and professional pride. ay, working hours, holidays, nsions and ministrative staff are a low-paid group with ow your firm is organi’ ut all those than 65 years TASS played tailored its organisation standards and the ad- BY TRADITION, clerical and ad- ue role in technical to the growth of large vance of professional education. Its technical industrial combines and codes of conduct. other things which are so important: your work-load, the type of chair you sit in, the amount of space around your desk, the temperature of your office, the lighting, the quality of canteen food and of office coffee and tea. TASS believes all these matters are open to negotiation. rocess, Many have skills which take as long to acquire and are no less important than those learnt in craft apprenticeships. Office staff need more pay, improved conditions, proper training and better prospects for promotion. And they need a RECRUITMENT amongvantageoftheloyaltyand professional pride which makes Of the 470,000 clerical and ad- sophistication in collective bargaining Yet it has never dustries and services, 270,000 are women. Women are joining the trade union movement at a truly remarkable rate. They provide the fastest growing sector of TASS membership — from 2,000 to 23,000 in the last five years. They realise that belonging realvoiceindecidinghowtheirwork toaunionistheonlyeffectivewayto ManagementstaffhaveapositiveTASShascreatedanational organised.TheonlywaytoachievethesecombatdiscriminationpoyBennie haye come to realise yare missing out iftheir are not rep some managers stand back from trade union membership. strong trade TASS; able to report the employees theyy supervise and establishment of new management provides forthem acommunications branches.Leicesteristhelatestone. intokthehighestleveloftheunion is goals is by organising and negotiating ual and opportunity. calls for contribution to make to the in- management advisory committee dustries in which they work. They which will be able to relate directly need a powerful organisation to the Executive Committee. Its through which they can influence through an effective TUC affiliated union. For staff in the Sneiae ae industries and services, that union is TASS. office Senta for ereny and leads the fight in the trade union movement for equality. Women are fast discovering that joining TASS brings real results: many hundreds of our female members have recently negotiated top rates of pay. Managers need TAS: S.They need an organisation which gives them separate representation from the inaugural meeting takes place this month. TASS regards this as a very significant step forward in ex:x New management branches are formed every events. And they need a collective voice to ensure that the size of their contribution is reflected in the tending the rights and improving month. This is the latest Leicester's first TASS is committed to helping wages and conditions they enjoy. the conditions of its management Too many employers take ad- staffmembers. management branch. TASS News & Journal January 1978 and under-paid. Their work is vital. Section organiser. low status and poor prospects. This is largely due to poor organisation. Until recently most office workers have remained outside the trade union movement and so have had no means of gaining the rewards and recognition they deserve. Bean angd, Maureeu,and +4pe cut my tax retums, nip out for wy wife's byrthday card, and ayrange formaweeklybronzin Ionat He. Young Apoll le Puysick!Miculture centre, It is high time office staff had a better deal.Theirworkisvitaltotheproductionministrativestaffintheengineeringin- of a million by 1980: we're on the way ound the divisions: the pace setters Quarter Let’s make it200,000 by May technologists, technicians, managers, computer staff, superviser; TASS covers them al, eering. staff improve sveryias ect oftheir working lives — not just the “big” issues such as You don’t get much for your money these days — unless you join TASS. It costs you £1.50 per calendar month to belong to TASS. For that small sum you get: Raat TASS members. Long-term unemployment benefit. Your monthly publication, ““TASS News and Journal’. And al the support and strength that you get from belonging to an effective TUC-affiliated union. All for the price ofa roundof drinks. ~TaSSisarealbargain The best bargain which it gave rise. It sets out the basic facts of white minority rule in a concise and readable form. The attempts to reach a regime's machinery of stitutionalsettlementwith MATERIALS technology politicalrepression,itsuse theregime. liesatthebasisofGe Free legal aid if you suffer an accident connected with your employment. Legal advice on your rights under the law. Freeconvalescentfacilities. Technical publications prepared by senior technologist —TheNewLaw’;by|altheActsofParliament nology‘whichithasmade : _ TASS News & Journal January 1978 EhOOKS (2a Page Nine Rhodesia:Smithsment. There has been a r- small erosion of dif- ' ferentials for manual skills. ! ilegal regime PEP say that these changes present the unions with a dilemma: “The This, says, means that there has been | 4relativeimprovement for thelower pala. majority to fight for basic “Zimbabwe; the facts et detention without raisin of low pay has for af har;r e and in- long major aim of timidation, political trials the policies of both unioo, ternational Defence and and illegal erections are and governments and has, Aid Fund for Southern described in depth, It to a modest extent, Newgate shows how asempts by resulted from the introduc- . London EC1; nationalist organisations tion of flat-rate elements 60p. mobilise the African into pay settlements. Thus about hodo. published by the human rights have been RECENT raids by consistently suppressed. THE the Smith regime into Mozamabreienqtirueleyin IntermsoftheAnglo- character with White American Settlement What should be the Rhodesia — a socie Proposals the regime's strategy for the future? which today is totally police, army, civil ser- mobilised for war and has vice and judiciary would always depended for its be retained virtually intact survival on the guns of its during the transitional expanding economy wil it securityforces.Anewpub-period preceding inbepossibletoprotectthe lication from the Inter- dependence. Yet these are position of the lower paid national Defence and Aid the very institutions which and at the same time Fund for Southern ec have kept the White re ‘ovide adequate dif- “Zimbabwe The Facts minority in power and been rentials for skull, training About Rhodesia”, shows responsibleforenforcingaandresponsibility.Thisis Sey EIN eBoy mass of racial laws and precisely what the trade ighty-seven years ago teen union movement has ‘You mei ‘ou have forgetyour |sete Mimi?. -Gay Parie? ...Th white settlers, financed by “Zimbabwe — TheFacts urging throughout the Liberation?” the British South Africa About Rhodes ludes current depressi ‘ompany,seizedeo)ofdetailedinformationontheEngineering Rhodesiathroughoy, strengthandcomposition anddeceit,backedupbi oftheRhodesiansecurity: sys Economy thehistory of the The Proport liberation movement up to the formation of the by Raymond A: Higgins) Patriotic Front and the publishor: chronology of British Stoughton; ical ta: 96. forces and the regime's counterinsurgency — oper- materials_ About Rhodesia” traces ations. Further sections the history of colonial cover ae franchise and domination’ and describes parliamentary system, the _Occupational cpearsitng thiprtaycticeyeaarnsd ae pradaluced a stupefying liversity of materials availablet,o) the engineer: pensions: the lawtransformed. sslectrieal pra and paver gation) into. the ied totothesan eondctor “Occupational Pensions] The last section contains and the “I'd like a word with you in my office, Bodkin!” Jam Jackso that are relevant to occu- blisher: The New ational pensions. ‘“Theproproepcetrties of metals goes Commercial Publishing ‘ocial |Securit,re Pensions far beyond those required Company; prico£11. ‘Act 1975”, a for paccuceanees modern tional Board metallurgy isacontinuii R. JACKSON has put Regulations”, Contracting quest tofind! the Tight together a book that will Outs on ot material for use in projects help all active trade Employments, | Equa unionistsonquestionsto ee do with occupational ne eimai and pensions. The bok iswel Review Procedure. There written and easy to under- are also relevant extracts stand, particularly the from the Employment explanation of the new Protection Act 1975, and Higgins has written a book which covers the field State pension scheme. Trade Union and Labour about as widely as a book Mr. Jackson outlines the Relations Act 1974. of this size can and in new Pensions Law, and explains the machine andterminology.The also contains a full ex- planation of the new State can recommend this sufficient depth to provide booktoanytradeaoe thereaderwithagood who is interesteid im- |general understanding. proving his members? ‘The author says the book ing against this read with profit by any on industrial tribunals, which makes itprohibitive. introduction to the sub- rks’ redundant.” msion scheme. It also was written for students of elps on the thorny Material Sciences at ad- talso discusses and ex- question of contracting in vanced technical college or contracting out of the level or first-year under- ain the roletrade unions avdy ihe scheme. ie ¢| graduates, but it can be rovisions and what would e required to contract out. ave to play in pension arrangements. It touches ponelisithe price of £11 engineer who requires an R.M. ject. The style is rather than mathematical(and) the text is illustrated by good relevant diagrams. The book isapleasure to ue dismissal of employees, andholdingcompanies. Winners and losersonpay Computing “Winners and Losers: when incomes policies have 7, Proceedings of the IFIP Congress ‘7, Price 65, North-Holland| This has been a period information Processing ‘ay This book provides in Alison show that the eeroeeace 1,000 pages a com- ;published by of the overal pay.pal prehensive survey of the an\d_ Economic has not been si; itfeane in most topical developments planning:price £4, most ranges of earnings in computing. It includes rthe very highest key papers on Fault- POLITICAL and Eco- where dif: Tolerant pod Planning have ferentials have been penientics and conducted a detailed in- diminished, and women's ions of Program vestigationintothemove-pay,wheretherehasbeena Proving;andPerspectives mentsinpayinthe1970s. Sighit relative improve- and Networks. Bee Patterns in tho both by by Christopher conservative and Labour Santosh David "The reaults of the survey government: Pour sfaterestaa the as varied as sonic air- craftandiiclonsreactors, The subject is complex and the field is wide with many specialisations. Mr. “I think Smedley’s getting a bit too uppitty!” WHAT CAN £1.50 BUY YOU? Two gallons of petrol. Ten loaves of bread. Three packets of cigarettes. Five or six pints of beer. - ~abesoeecnpahateregensDirect-access’to: professional full-time officials. Effective and appropriate advice. ; | ricity Boardandafter theearlydays ea pee: . ; DRAFTINGPERSONNELREQUIRED Ve GENERAL DETAILERS ATTRACTIVESALARIES&CONDITIONSts 2 Manchest Whom youneed it bien ihe conversion|| ropes Labourarty june!aE eSaECY)ouey ‘Theschemewillbeofneed TEN esto iccDantonWinemeee . ! a —__———a u al 0 | | 1 e ¥ ~ Page Ten a [ i Page Eleven - 6 Preteraby,aplicantsticalshoEunlgdineoelrdingat,lahsavteanserveadO.N.C.reocrogenqiusievdalternaitden ae scansondpomnedDireseonen ots ‘perience Tel.Rickmansworth76352 technical staff at Alfred On top of this Heche Coventry. marabers Received theirin i - =a . stl veenquire aetnapape those ( foc yaare) £5permonth,dependent dificultiesinattempting individual contract|||gGjent,aA2UE5Dshop steward. ie 0 i leastminimum standardsofpayand WEREQUIRE t . conditionsarebeingoffered. SHIP? recommends IS MECHANICAL in in yaissetTmoBoe ns |Sieeeptsnaeeee ata COCs eee epsoei ES cularDundeLebDiosturicrtf(eEa Jw hes E PEOPL Ee man oe its active mel i DRAUGHTSMEN/WOMEN ines x ha uanoee pee anERS, (Male/ ngenginers/designers,preferably PLANNER ELECTRICAL INSPECTOR TASSIs oferi another s. isoffering yOeftfi ‘ervice to its members. Frank says Joe Ashton, the Pubintheirlives.“Down tp he there, the NF don’t need Draughtsmen / ias e al;l rni sophisticatedarmamentequipment, miselaunchingsystemsand NavalGunMountings. faloteeeestion Caries tahreieavBaiOlOa)bleOvfrerenefarsolm \OJECTSLTD., pases ie SAUtwe/eAnRY18%iancdreas2e1s% TASbiScaseattheCentral — — the Honea . sae 5 Arudimentaryknowledgeofthepurchase,estimating and quali ae ROYA Warvoquieiate mobrtdssaniavels were won We the level ofsalaries plements paid under but alatewb flycorienscrateethexperienceneeualifcatons : ¢ by pueteseereastMee linewiththoisnedusptrayinthe Pprincesaethiaavherdag.epayse|SPTASARSISKE.memetbeArCsTIOaNt,SStattaitce AR London Bwalsackb workingcraffto)r BS es Se Sea Dr . D tsmen/Drau swomen foventry area. * gite’s TASS ‘|Office Back ‘bay, of the GAC ton, has Se eaeOae e aug) Je design and manufact lowance is pea Xsshoud wat,givingflparticularincludingage,presentaan ncaa VickersShipbuildingGroupUmi,BarrowLAIEGng1in9)e~eringingWWorks, BakaasBanroucknForeee!Cumbia eure Roplivantasnotkt uxketoh a a in Thescones ny was Upkar Abrol presented the iecrensaawas expected when he was for payable, ai cdraughts: and.foury : 7 nae alitieations orvsaliceatriosns:—pauOi.vNal.eCnt.sot(Mehcihg)h,e/A&dvenGgiPnaretstIilo(g293)s,pEng.eninstc.e(CrE3) ope He Eecae,att0ended weTrokintgheinWmeesmtbersLandonhe ar "thefaerhraed”toeeget|rightawayand tal olinengineering. Somepractical ie Suacie: i hsoil be2ovoverer211iysoaresof Green, Deputy ice Mani * “After several years it flowing BroGa modified cover. No min are STOaT ATEEa a ae : pore Te elonae breacinaclhpuBrhposperoducwtoldion international OFJ] PIanrethnetafilrstOlifnisctearn)cepleaseaplyinwritingto TRACER FROM ‘TIME totinethis Reaoc roothinwgasa,noeIt aNJn’ lasrte Tmeopnotrht,edihne " STUC,inthepovt-World|] awiderangeofbothstandar macunanyusedinalmostevery Forover25yearsWilie|}:72ree"tnreainingwillbegiven Ecrarad Rin Ayrasirance oduct forStafApplicationFormto oapply mmembersabout PBERROSOOKNENEMLARIMNAENALGTED.R, HEATH ROAD, abana ..0602/65221 M DRAUGHTSWOMEN eee Efedwcansvacemewihcotpricei £T2r,0a00ep.a. jobsothats = which his knowledge oes exceptiona f any Bish FederalWelder @MachineCo. Ltd., lneomprornising as,the in Parlian st e for PAST, ;ESIDENTTPaine their tirst||Busey, eek IDLAN! atin, 1e = theores memberreas Piorincecaurmnarkesra/wacehcehseneTGaiktaing theexamplo ofa disabled. If unable to dthiadtitthoehiNgahtlioingalhtheFrfoanct caFuant “through these fener tsfromul'uverith0) onwWikel (worked tania! INDUSTRIALSILENCING LIMITED 77 UDoccmber 197.Atahnids alfefauirs Exchange aoa whicl 3 acl surerstoour unionsince° fanerai viends UK 0, AYenginerwiththeScotish BURGESS wilshortlyhavevacanciefsor HT ent of anacident or sickness, promia are waived ununtil e WouldaeOreShireesteseWorke(nr c0ofntrolthePres,smash whobecomes anMP isretireimntenretstherreteacined a Amountof Monthly ORME or ; Der9eceel paymie.nt e 0 cer stsatattions and energy “FOR YEARS we 7 DRAUG SMEN/ Pranticeshipionv!edne(list_sep-peavasnoOemyeYtsesonea||WOMEN/DESIGNERS / mitteeacaeeesarhea les £292.04 £5.050 FFWytetaebreabrekgrlootieamee, fog.oesGeofnerbalalck pAemoinp.l”ebacOkf aroeviews, aCAcording rie sc~hkenowmneasthe 5 $32,549 $5.00 Siclosinetiie heslea BsHHsityopportunitytoleamthetechniquesof percaeedyie apenas tpoblicy/sherseidbeeGetaniyaweaross £7.00 srhere|CablneUMinsstora!people,whobbjectedita|puyiPeupeacelite Vickers Shipbuilding Group Limited DickWeolt him'lASSwontseemthe receptions ro inhis i roe ‘ompam Shipbutcer : experience.Oneyeardrawingofficeexperience. Deb isemusasbuasncreivpetion10 a anual from} o tion staf fa IRE ee ona oe He was fee to the a — TEL ce) 35 workfora periodof the, “Guardian wepeteragerds thansixmonthsbecause pypepaluaneraployl-ise "TASr.egulJarournalwarticlesereir sickayand MANSIGNENGINEERINGareengDaesgiegdnoinlybotohf Se e"alec opeel WNoeise,Chonetrnol (altsncarsParalocouriioallirent ve seuenslismectary and $7.50 dotheirpartypirehcuebsarbto thatalseemedtolivein the next venture.for and Macaee & tetheyoungpeople wi mentinthefieldofEnv‘uicrtuornamlentanldEnMgeincehaearnincga,l AHtiome ¢tiadtisctersiesSpecklor tuhpeteeAutomotive & ofered at, terms,whic! if wherenotMemobteairnablear.elseo-k 9 #80 th:e,‘tunwehandt'osfv,ieownersnextl”ok neovuteervisiutbeudrbiana:E Sthuey'dd ATAs:hton talenetnedtedMP MPJoeJoe £9.050 tosce ste od a = whoheombe camein contact. criencelulding related Structural ifneattGtetenTiny UScsteiscmsTthuinvredsat||mGoiondimucmovente!chnicdaulcotqounaiicisatmionecetdo.OwNinCe||fPoliloewi\nogcpue.rsmonenedeatowowraktinloaudrNweOTTiIeNGHAbMe ‘Asayouhetjohinedthe JOHNROWAN|| B2sicexperienceinfabricatead/structurmalaystelb-e workpreferredbutotherdisciplines tGnhder’provciosnitotnasntofrtehvieiwBentTelealchyenaort:edHotwheatverth,eathgeaimembfietfrorswor n anoth ees man r esi mins er $ fCgre DIES — CHECKING FIXTURE ae Abplieations) indicating minimum salary MSAPTEECIRAILALPSURHPOASNEDLMIANCGHIDNREAUGHTSMEN. theamountoflifecoverThisautomaticstepingfixedtermcovertobe erionded ey fren ge ount,of aia athetaken outandiconverted ROL GOLNGENASSENELTTOO JIG&TOOL reqaundicronvenident:datefor:snterview, DESIGNERS Full”dteImlted the doublesinninevenrs:” Soracatet forme! | |Tass seh tbceWhenyoureadie syutioonorion||Rosebatnnchorea A SeaeySeeeTe ShaftesburyAvenue, Apply to: = MAN: examination. 11Grades —‘TopSalaries_— eae = Peedi interest. to LaeitEplicationformsmeried_couples.|,\¥hEDYouareceive&©|P|soughtCeUaethitnthoebnexatsaelecLtiaobno.ur J.F.HOLLAND, LTD. 46-52 Church Road, London, SW13 eae ENGINEERING EN TyneenWeen, Tel: South Shields566721. ELIE Soca ROLLESTON DRIVE, ARNOLD, NOTTINGHAM. Tel. ter ofayoun should ae Ye|_| here bedisastrou fr eatpe Ernie, pictured 01-7480794/5 How itworks parentcan wu pierly wore ae Me. A. Jones, Burgess Industrial Silencing Limited, preee which is at present held STs lls nS Discrimination rmofnine years, willin special a ca apolGuTCRSLreSoniterextremFane PereO 3 is unlawful ENGIN DRAUGHT. tpan the amount the to pay the mortgage, betwoen Guardian individual “wishes to bring upyoung chien HoyaliExchange’and the’| [leaestered coAtA five = | Employers who adver} tiseJobs for“Draught fen"of“Engineersare EERING SMEN/ assurance protection is |f lence ane required, These premia living. Tagusceiavavedeinnin:with = , ret,Man- chesterMSSHN. nsworth,Herts. Ce centwerewonbya ge eineaa TASS a 1 a 1c STEELWORK TASS eensoe for blic . foes oCanetined union in the motor | ational conference é Wieond(tice|cecrondkaren) | DRAUGH have Southetn hoopleany biatce s 5 vtehreyberleioaflthanteeditmaenodt.sisa e in breach of the Sex \dvertisements make anderson] Projects design and build plants for gheeoetakelat|Members tiaicsthecompany. Pan breakthrough for Divisional caineected | tad menutidaAncdevertoinsingEmplo:$4 osfeplanatnidlojauyonruito,rlDowrsheaetus,gphiwpitnhgseaxmnpdereieqnruicpe- mentAdvertisingPractBlmentdetails.Dutiesarevaried . nd fees Pons permanent . Jacanexcistiteors oeaeeSSSenPoseee BEq|ezplaingincomedetail!Applicantsshouldphoneorwritegiving asubstantialoay|inalhisunion,political WestLabourPartya See sees e 1976. ordree his |S esandSeservicecen-e|afagiatresledtheimtoejoienethe sea;soned wShoernecect tidewil Chemic a al evenbeeklats triesandnowrequireadditional th . D R 4 REQUIRED Life S Alladsarecheckedtoseethatat WITHSHIPBUILDINGEXPERIENCE } urance . 2 a IPandremaineda0|aay] ENGINE&ELECTRICAL sh u a ||YOUNGENGINESRfeSm!ale) me 0 mem . Quality Control Dept.) (For assurance scheme which the ane he La P. foc hasa rey DEaMdCESEen ike beeen naa DESIGNERS TOOLINGDESIGNERS es.andtonegotiate{heamount|ofcover It'sflexible pecnaseReeemployers Sa eae eeccen The flexibility ofthe M es ech an ic al sANDEnson ay ging Director, cin ho ht Saunton Tupentifecture,high!performancemilitarysmallarmsand STapmneat pderoadwingdoefsficgens/,detdarialuignhgtinorgPjige,RtOooNl,ATfixtUureNanTdOgpaeuxgpetidoenscisgnuinsedeithfeor Double, issuley,sis Froi A es yofevents, were ditshmeirssceoldleagues | the furniture makers November e ne} . high volume production mainly by a ining wil be given ya semi-skilled work force. Some wentintoAfatcetri.ononseviereael matakitnhagtrtlidmerstowereinbvuasdye ye bebalf. Eu: ¢ 2he ctical vest Einhoutaormetentaatcr many saltAareome|tbeyayreedtolacksparse ExecutiveCommittee However, Dick makes it friends,bel beback in CLIFF 5AO, post fre, TiedUte:|onepion. Saneofeats 1944 but only attended LEAVALLEY763333 EXT.224 (Finchley) pain Arenege plasinstall p die ic an Repeorbes emew life oti it,18potmedicalevidence,an Availabililtifye ofadsesautrhbaence: ®M{imiYee" pw in ane even those withiabealtt two 5e0yearswilnotnormally Raearoce theouch, eanie, weTequire supportin pfieter socrton: TASS is here to sive oir lable below average i came back with Government whip which webelieve| Year AESD,whichw Zutobionraphical. ie LTD. pacehinst NOTTINGHAM269216. aecaverplanisforinadequateandaSeeaeen eee: A U G H T ING S W O ME N life and aintain member and continue for rensferrete ‘spendandhowmuch a eect ofaslongasrequired.TASS||TASS"represerbena igible forta,relief Members n d dividual contracts ) |SoncuitearoSine |Scastemnceties eee fieiveersyGoa tC mstheScottia Opportunities andinvolveparticipationfromcoastmare mem erswin the:pabeadieolticensastaltaSgoEandehiseworkheasbeeeeEnentetiieDasieeeresee t LSMALL ARMS FACTORY ENFIELDLOCK,MIDDLESEXEN36JL S comenssioniog 1 endeeeal|rsa!ndtereela,euetntgsand 2percent a terest e = esResolutiotonritebring,Scaonsolidating,ak’sSup: in increasesunofder10tphercFeanit aNonvneumabler inofcr10e ~ - ppzinearing Switching, Wolverh: Dick Woolf |trade SMT is a leading | delegatein eceived obs back s cr e est} won Wolverhiami | (etieal Die Ger dedded ita movethe design office out of fechairmaawardandtheannualpay|©twomembers. afDict1k5eyfeirarsrts’joisneerdvicTe.ASSTarifaHemeedtontta) LABOUR Mtapolitical in havewilyour Reinewil G0: misesue.JanuaryFebruary "in| man oe"Harris Lebuwsh,o reeDlieccktedsertvoetdheonEC.the EC Ballards 2PD. This represents an im: stwo ne ae major, part Jemployers (by then he Lane,|RavedecidtoejdoinTASS.SsBeythe iteone completedtheround‘offorthemovement. whenfive TEAEue Ha Chi — a timely| organise only last July. in 1941 MONTHLY|Christmaspresent veeks, reinstatement was | German-occupied the a cot < popular feature. coreperony abou fon bale just written a nov pnsopioyes jeohelens ‘Grass Roots”, about a "enchtsiti corei sips,Pay inoBntainandspar received, to the e formanyyearsaleaderinwithconfidencetothe memberin e g and community work andwas He t : by|pfearaerinc19e4a3 can tsheorsvediawoholowyaolrlyk.edandwit1h0 ee action. “ yeat c M ‘and W , is looking forward can get anoth TEAS in same without Dick. honour meeting before his clear that when he's harness working unpaid s N e n e c a | the 1978 consus TASS carried out at she coy Asthe General Secretary | j,hound tocontinue. Itis longer hours of overtime computerised system General Secretary Ken Gill the third week in Januar) cints out: “We have the vital that TASS is and round-the-clock being introduced. said: “It is in the interest and TASS Correspanene Post sophisticated salary | Trepared to cope with shifts @ Ensure that the Pe : Si Ny be ns Oxford,from16thtoSond Considerationwillbe Thereareawaysmore andmadeafatpofit== July. Forty places are given to any loss of pay or 4pplications than places ; he TASS salary , their investment worth- ”mistorscalcontinuityofthereecetémoreaeesCRaatErwhilaeThalcancloaditorfillestconaultetiona — ‘ jared very important Central . ArbitrationCommittee tribunal given of the way the iser, Len Formby, told the < replace the traditional mode of work of our technician members and substantially reduce the demand for skilled designmaybeintroduced are stro! " Discussing the plans for The census will CO aa 7 ded design. This trend attempts to introduce in advance of any of every "member to Members. W to every census available to any | these situations, jobs of al existin complete the census form census forms toSCY trade union. It is crucial When the system is Better: not worse _ personnel are protecte: andreturnittoHeadoe ProrkpiaosWellthatourmembersmake beingsetupitcan andthatanynewjobs OfficesThisrie)essential-inike“300000.individual thebestpossibleuseofthis generatemoreworkand Technologicaladvance, risingoutofCADare informationinordertoover2000|t0ne0 by.ensuringthatthe|createtheneedforextraincludingCAD,shouldBivsteaffnaltreadoyon Emeror’ Ee ae ap hota indicates that maximum pombe pct staff, pee Boh fy improve the lives of tbe Payroll, with Special conditions of al o! oS ac loted ‘orms stalled it greatly speeds ror! raining where necess- Rute motors, time and a quart crials and weekday overtim te BOB ee Tea {2informationcovers age,comPyedtoHeadOlfice.1|uptheprocesofdesign Jadteshorterhours SFY. 2 eetonHeadlengthoftheworkingweekurgeallCMsandmembersandproducedanswerstomoreleisuretime,moreTMInsistonsub- nee HSER 14th an “whether ornot the toacalsae a problemssewicspool Sanitontablay working ae increasesaay, S ~ nm concerned is a_ possible F seldom hav: conditionsand more pay al employees whose andnaenson-meCmbeSrs Ear P5atna This informartAiSoSn tyoear'simpcreonsvues pwute el u whensly desuipgonn coneunmiaten ItSeesrhoueltd n=ot lead to work is affected by~ the in" establishmentswilbeprocesseadtTAS COnditionsthisinformation|Faculties. heavierworkloads, Tewsxstem. 5 PaAEooeereturnedandthedetailedisessential itali shiftsystems,andshorterworkingweek, the ish eo ;— results will be sent to al peaiBE areasoftheunionasanaid HAVEYOU Capitalinvestment jpounting unem- longer holidays, a ee rte lar er and to prosecuting the fight to COMPLETED AND Computer aided design and computer controlled production processes ployment reasonableworktempo and proper leisure a palary raevey improve the salaries and RETURNED YOUR olaced by any trade conditions of members. CENSUS MATERIAL? a in Western Europe In the conditions of free iFNOT, DOSOAS and is a more detailed collective bargaining it 15 | soON AS POSSIBLE. census of engineering staff essential that we have the Guidelines WollurgenASs periods, : Organise Wages “fair” but - Overtimeupped TASS'S NORTH LON- § DON women organised a highly successful disco last month, The No. 24 division hada Ehcroge Ely enjoyable time and made a handsome profit too. Connie Bloomfield, DC Delegate from the Divi- sional Women’s Sub- Committee, is seen here presenting a cheque for £105raised atthediscoto Richard Thompson, No. 24 Divisional President, for the Divisional Develop- mentFund. Connie says: “Social activities can do a lot to win new recruits. Other divisions might think about holding discos.”’ TepS 2peaTuas=mee ‘ } rd e Si ; AWAGE CLAIM areatpresent142 m 84 are ction workers and 58 f. The TASS claim aear mn col ac sasiPrac and typists However’ t were within the win an award fo: nerallevelforthearea pay.Ourmembe Bob aie joins Dickinson, 3 getting only £1 an The company manufac The CAC increased hon F en rotection its disciplinary procedures what lengths smb yexs and its own conditions of pall go to,Lossck peopt ia servic fancy words are us! esumm r , available. All TASS bers are eligibl y forfeited holidays Don't delay! The closing date is Monday, 13th \ computerised design with their own particular management, a March, 1978. Write now to Scholarships will cover the General Secretary, the cost of board and resii AUEW/TASS, Onslow 1 dence and travel in excess Wall, Little Green, Rich- s time and a half ntatives who countries a top-level Philips pl ; ended| the functionosf the former 1 AC was set up in 2 eae unten the nin companyhaddisregardedinterviewer,“Itisamazing r Ps, cavenedadbyby thethe tchoensidmercetding. where they what questions|IBnodaursdt,rialandArbhiatsration| TASS member Bill Daonal Harvester Co.had oother example of sick John Tuchfeld Europe}8droppedfrom|representativesofem-manager,Mr.R.B.Parke: ey 82 to 72 per cent of the| ployers and — represen-| had ordered Bill off the total employed worldwide. | tatives of workers. premises with the advice } members to notify the union as soon as they hear that computer aided be offective if employees hool|manualworkers.Sinceattheirworkplace.Weandanalcreanieed =|hugecapitaloutlayisshallthenbeabletogivequicklyandaccuratelyto necessary to install a advice on how to deal any initiative by eS mond,Surrey,TW91QN. = : Bob Dickinson eran retired TASS Aésistant thathewas“struckofthe awarded £5,420 compen: oll” Benson recently General Secretary, has| ps . = etin SecretaryofStatetothe WINS PehurtherevidencewasTASSDivisionalOrgan- een appointed by theBill lthas'takenoven decision ee baffle us — repudiation of Finding that Inter. contract indeed, it’s just future. The most pressing | provisions dealing with | heari which tribunal makesact issue under discussion was | trade lasted tw union recognition, daypat econ any clai na contractiand domestic car- the company’s long-term|the disclosure of in- he had ‘repudiated his o planning intentions, in| formation to unions for contract” by refusi ita view of its apparent shift| collective bargaining, and performalternative we k of employment from| the extension of terms and | The Tribunal rejected Europe to the US, Africa| conditions ofemployment. | this argument vate andtheFarEast.Inthe| ‘TheCACconsistsofa|evidencehadbeengiven lastsixyears,thenumber|Chairman,oneormore|thewaytheae of It Noli: perfect goo of Philips’ employees in| deputy ak Chairmen, | industrial relavions prireturnCatherleatan ohare UK " i- EuropeanMetalworkers’shouldberaisedwhen|ditionallynewresontpeeaves) eee4 iiti nes succeded Hargreaves ithaliIribanal Federation in Brussels on the Philips central | sibilities, under the Em- against inh ee inanadesustry.E ae a management meets | ployment Protection Act, arvester Comaitca: 4 ¢ ) > \. ¥ members of the E or hearing complaints and | Doncaster i Se Executive in the near | making awards under the At an industrial AUplopal ey a TASS News & Journal January 1978 Page Twelve output in order to make should be followed are:— This approach can only 4 ia gpeME —Showroom and fitting service in most areas.—Postal quotations Filinthe census It'sinyour interest design is not new. TASS has been e on its progress. We do not take a (CAD: itshouldbe =) used for a better life COMPUTER aided ci sU vages than any other, maximum information keeping a watchful e eee MyETASSIncludingthoserunbytheavailableoneee eaditeviewtomoderntrendsbuttherearesafeguards providesauniquesurveygovernmentAnytradesalariesStyourwhichTASSmembersshoulddemandfromemployers ofthewagesandconuanionist,empleytjtionmnembers; ThisisPe|\ichingtointroduce in vi " CAD. Harry Smith, National eonsosseeeraaninewantinginformationontheticularlysportSE Organiser,outlinessomeofthem. \ since 1923 and is unique salaries and conditions of of the Phe vie OVER RECENT months system, not only for the breadth of staff employed in the base 0! ber managements circumstances. of job cccaggroupeWOnaTASS will want to maximise general guidelines The which ; ‘ y wil eater the num information but for the engineering industry will wr egoriea we cover the sumbers have reported idbe Creator An entity primarily responsible for making the resource TASS Source A related resource from which the described resource is derived John Allan Date A point or period of time associated with an event in the lifecycle of the resource Jan 1978